Rabbit GNPTAB Polyclonal Antibody | anti-GNPTAB antibody
GNPTAB antibody - N-terminal region
Gene Names
GNPTAB; ICD; GNPTA
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNPTAB, Antibody; GNPTAB antibody - N-terminal region; ICD, GNPTA; anti-GNPTAB antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG
Sequence Length
1256
Applicable Applications for anti-GNPTAB antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNPTAB
Protein Size (# AA)
1256 amino acids
Subunit
s alpha/beta
Protein Interactions
AEN; ZNF250; STAMBPL1; FAM90A1; PSMA1; MAPK1; APP; UBC; DISC1;
Blocking Peptide
For anti-GNPTAB (MBS3209652) antibody is Catalog #
Preparation and Storage
For short term use, store at 2°C to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-GNPTAB antibody
Target Description: This gene encodes two of three subunit types of the membrane-bound enzyme N-acetylglucosamine-1-phosphotransferase, a heterohexameric complex composed of two alpha, two beta, and two gamma subunits. The encoded protein is proteolytically cleaved at the Lys928-Asp929 bond to yield mature alpha and beta polypeptides while the gamma subunits are the product of a distinct gene (GeneID 84572). In the Golgi apparatus, the heterohexameric complex catalyzes the first step in the synthesis of mannose 6-phosphate recognition markers on certain oligosaccharides of newly synthesized lysosomal enzymes. These recognition markers are essential for appropriate trafficking of lysosomal enzymes. Mutations in this gene have been associated with both mucolipidosis II and mucolipidosis IIIA.
Product Categories/Family for anti-GNPTAB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
143kDa
NCBI Official Full Name
N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
NCBI Official Synonym Full Names
N-acetylglucosamine-1-phosphate transferase subunits alpha and beta
NCBI Official Symbol
GNPTAB
NCBI Official Synonym Symbols
ICD; GNPTA
NCBI Protein Information
N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
UniProt Protein Name
N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
UniProt Gene Name
GNPTAB
UniProt Synonym Gene Names
GNPTA; KIAA1208
UniProt Entry Name
GNPTA_HUMAN
Similar Products
Product Notes
The GNPTAB gnptab (Catalog #AAA200045) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNPTAB antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNPTAB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNPTAB gnptab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQFGEVVLEW SRDQYHVLFD SYRDNIAGKS FQNRLCLPMP IDVVYTWVNG. It is sometimes possible for the material contained within the vial of "GNPTAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
