Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46383_IHC8.jpg IHC (Immunohistochemistry) (Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

HIF-1-alpha Polyclonal Antibody | anti-HIF-1-alpha antibody

Anti-HIF-1-alpha Antibody

Average rating 0.0
No ratings yet
Gene Names
HIF1A; HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
HIF-1-alpha, Antibody; Anti-HIF-1-alpha Antibody; Hypoxia-inducible factor 1-alpha; ARNT interacting protein; ARNT-interacting protein; Basic helix loop helix PAS protein MOP1; Basic-helix-loop-helix-PAS protein MOP1; bHLHe78; Class E basic helix-loop-helix protein 78; HIF 1A; HIF 1alpha; HIF-1-alpha; HIF1 A; HIF1 Alpha; HIF1; HIF1-alpha; HIF1A; HIF1A_HUMAN; Hypoxia inducible factor 1 alpha; Hypoxia inducible factor 1 alpha isoform I.3; Hypoxia inducible factor 1 alpha subunit; Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor; Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor); Hypoxia inducible factor1alpha; Member of PAS protein 1; Member of PAS superfamily 1; Member of the PAS Superfamily 1; MOP 1; MOP1; PAS domain-containing protein 8; PASD 8; PASD8; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); anti-HIF-1-alpha antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
850
Applicable Applications for anti-HIF-1-alpha antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46383_IHC8.jpg IHC (Immunohistochemistry) (Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemistry)

(Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46383_IHC10.jpg IHC (Immunohistochemistry) (Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohistochemisry)

(Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46383_IHC11.jpg IHC (Immunohistochemisry) (Anti- HIF 1 alpha Picoband antibody, AAA46383,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- HIF 1 alpha Picoband antibody, AAA46383, Western blottingAll lanes: Anti HIF 1 alpha (AAA46383) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SHG Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 120KD)

product-image-AAA46383_WB13.jpg WB (Western Blot) (Anti- HIF 1 alpha Picoband antibody, AAA46383, Western blottingAll lanes: Anti HIF 1 alpha (AAA46383) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SHG Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 93KDObserved bind size: 120KD)

WB (Western Blot)

(Anti- HIF 1 alpha Picoband antibody, AAA46383, Western blottingAll lanes: Anti HIF 1 alpha (AAA46383) at 0.5ug/mlWB: Recombinant Human HIF 1 alpha Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD)

product-image-AAA46383_WB15.jpg WB (Western Blot) (Anti- HIF 1 alpha Picoband antibody, AAA46383, Western blottingAll lanes: Anti HIF 1 alpha (AAA46383) at 0.5ug/mlWB: Recombinant Human HIF 1 alpha Protein 0.5ngPredicted bind size: 36KDObserved bind size: 36KD)
Related Product Information for anti-HIF-1-alpha antibody
Description: Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HIF-1alpha (Hypoxia-inducible factor 1alpha, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1alpha transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1alpha regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.
References
1. Sutter, C. H.; Laughner, E.; Semenza, G. L. : Hypoxia-inducible factor 1-alpha protein expression is controlled by oxygen-regulated ubiquitination that is disrupted by deletions and missense mutations. Proc. Nat. Acad. Sci. 97: 4748-4753, 2000. 2. Elson, D. A.; Thurston, G.; Huang, L. E.; Ginzinger, D. G.; McDonald, D. M.; Johnson, R. S.; Arbeit, J. M. : Induction of hypervascularity without leakage or inflammation in transgenic mice overexpressing hypoxia-inducible factor-1-alpha. Genes Dev. 15: 2520-2532, 2001. 3. Koshiji, M.; To, K. K.-W.; Hammer, S.; Kumamoto, K.; Harris, A. L.; Modrich, P.; Huang, L. E. : HIF-1-alpha induces genetic instability by transcriptionally downregulating MutS-alpha expression. Molec. Cell 17: 793-803, 2005. 4. Ivan, M.; Kondo, K.; Yang, H.; Kim, W.; Valiando, J.; Ohh, M.; Salic, A.; Asara, J. M.; Lane, W. S.; Kaelin, W. G., Jr. : HIF-alpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O(2) sensing. Science 292: 464-468, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95,634 Da
NCBI Official Full Name
hypoxia-inducible factor 1-alpha isoform 3
NCBI Official Synonym Full Names
hypoxia inducible factor 1 alpha subunit
NCBI Official Symbol
HIF1A
NCBI Official Synonym Symbols
HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha
NCBI Protein Information
hypoxia-inducible factor 1-alpha
UniProt Protein Name
Hypoxia-inducible factor 1-alpha
UniProt Gene Name
HIF1A
UniProt Synonym Gene Names
BHLHE78; MOP1; PASD8; HIF-1-alpha; HIF1-alpha; bHLHe78
UniProt Entry Name
HIF1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HIF-1-alpha hif1a (Catalog #AAA46383) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-HIF-1-alpha Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HIF-1-alpha can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HIF-1-alpha hif1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIF-1-alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.