Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46449_IHC13.jpg IHC (Immunohiostchemistry) (Anti- IDO1 Picoband antibody, AAA46449, IHC(P)IHC(P): Human Lung Cancer Tissue)

anti-Human IDO1 Polyclonal Antibody | anti-IDO1 antibody

Anti-IDO1 Antibody

Average rating 0.0
No ratings yet
Gene Names
IDO1; IDO; INDO; IDO-1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
IDO1, Antibody; Anti-IDO1 Antibody; anti-IDO1 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
403
Applicable Applications for anti-IDO1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- IDO1 Picoband antibody, AAA46449, IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46449_IHC13.jpg IHC (Immunohiostchemistry) (Anti- IDO1 Picoband antibody, AAA46449, IHC(P)IHC(P): Human Lung Cancer Tissue)

WB (Western Blot)

(Anti- IDO1 Picoband antibody, AAA46449, Western blottingAll lanes: Anti IDO1 (AAA46449) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Spleen Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: A549 Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugLane 6: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD)

product-image-AAA46449_WB15.jpg WB (Western Blot) (Anti- IDO1 Picoband antibody, AAA46449, Western blottingAll lanes: Anti IDO1 (AAA46449) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Spleen Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: A549 Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugLane 6: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD)
Related Product Information for anti-IDO1 antibody
Background: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.
References
1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., Belladonna, M. L., Fioretti, M. C., Alegre, M.-L., Puccetti, P. Modulation of tryptophan catabolism by regulatory T cells. Nature Immun. 4: 1206-1212, 2003.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
indoleamine 2,3-dioxygenase 1
NCBI Official Synonym Full Names
indoleamine 2,3-dioxygenase 1
NCBI Official Symbol
IDO1
NCBI Official Synonym Symbols
IDO; INDO; IDO-1
NCBI Protein Information
indoleamine 2,3-dioxygenase 1
UniProt Protein Name
Indoleamine 2,3-dioxygenase 1
UniProt Gene Name
IDO1
UniProt Synonym Gene Names
IDO; INDO; IDO-1
UniProt Entry Name
I23O1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IDO1 ido1 (Catalog #AAA46449) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-IDO1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IDO1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IDO1 ido1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IDO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.