anti-Human IDO1 Polyclonal Antibody | anti-IDO1 antibody

Anti-IDO1 Antibody

Cat. Num. AAA46449

• Gene Names: IDO1; IDO; INDO; IDO-1
• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: IDO1, Antibody; Anti-IDO1 Antibody; anti-IDO1 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Isotype: Rabbit IgG
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 403

• Applicable Applications for anti-IDO1 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- IDO1 Picoband antibody, AAA46449, IHC(P)IHC(P): Human Lung Cancer Tissue)

WB (Western Blot)

(Anti- IDO1 Picoband antibody, AAA46449, Western blottingAll lanes: Anti IDO1 (AAA46449) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Spleen Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: A549 Whole Cell Lysate at 40ugLane 5: SW620 Whole Cell Lysate at 40ugLane 6: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD)

Related Product Information for anti-IDO1 antibody

Background: IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.

References

1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., Belladonna, M. L., Fioretti, M. C., Alegre, M.-L., Puccetti, P. Modulation of tryptophan catabolism by regulatory T cells. Nature Immun. 4: 1206-1212, 2003.

NCBI and Uniprot Product Information

• NCBI GI #: 4504577
• NCBI GeneID: 3620
• NCBI Accession #: NP_002155.1
• NCBI GenBank Nucleotide #: NM_002164.5
• UniProt Accession #: P14902; Q540B4; E5RGR8; F6M9T7
• NCBI Official Full Name: indoleamine 2,3-dioxygenase 1
• NCBI Official Synonym Full Names: indoleamine 2,3-dioxygenase 1
• NCBI Official Symbol: IDO1
• NCBI Official Synonym Symbols: IDO; INDO; IDO-1
• NCBI Protein Information: indoleamine 2,3-dioxygenase 1
• UniProt Protein Name: Indoleamine 2,3-dioxygenase 1
• UniProt Gene Name: IDO1
• UniProt Synonym Gene Names: IDO; INDO; IDO-1
• UniProt Entry Name: I23O1_HUMAN