Rabbit IDO1 Polyclonal Antibody | anti-IDO1 antibody
IDO1 antibody - C-terminal region
Gene Names
IDO1; IDO; INDO; IDO-1
Reactivity
Tested:HumanPredicted: Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IDO1, Antibody; IDO1 antibody - C-terminal region; anti-IDO1 antibody
Host
Rabbit
Reactivity
Tested:Human
Predicted: Pig, Rabbit
Predicted: Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Sequence Length
403
Applicable Applications for anti-IDO1 antibody
WB (Western Blot)
Homology
Human: 100%; Pig: 79%; Rabbit: 93%
Protein Size (#AA)
403 amino acids
Protein Interations
UBC; APP; TERF2IP; PPP1R16A; DDX24
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-IDO1 antibody
This is a rabbit polyclonal antibody against IDO1. It was validated on Western Blot
Target Description: This gene encodes indoleamine 2,3-dioxygenase (IDO) - a heme enzyme that catalyzes the first and rate-limiting step in tryptophan catabolism to N-formyl-kynurenine. This enzyme acts on multiple tryptophan substrates including D-tryptophan, L-tryptophan, 5-hydroxy-tryptophan, tryptamine, and serotonin. This enzyme is thought to play a role in a variety of pathophysiological processes such as antimicrobial and antitumor defense, neuropathology, immunoregulation, and antioxidant activity. Through its expression in dendritic cells, monocytes, and macrophages this enzyme modulates T-cell behavior by its peri-cellular catabolization of the essential amino acid tryptophan.
Target Description: This gene encodes indoleamine 2,3-dioxygenase (IDO) - a heme enzyme that catalyzes the first and rate-limiting step in tryptophan catabolism to N-formyl-kynurenine. This enzyme acts on multiple tryptophan substrates including D-tryptophan, L-tryptophan, 5-hydroxy-tryptophan, tryptamine, and serotonin. This enzyme is thought to play a role in a variety of pathophysiological processes such as antimicrobial and antitumor defense, neuropathology, immunoregulation, and antioxidant activity. Through its expression in dendritic cells, monocytes, and macrophages this enzyme modulates T-cell behavior by its peri-cellular catabolization of the essential amino acid tryptophan.
Product Categories/Family for anti-IDO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
indoleamine 2,3-dioxygenase 1
NCBI Official Synonym Full Names
indoleamine 2,3-dioxygenase 1
NCBI Official Symbol
IDO1
NCBI Official Synonym Symbols
IDO; INDO; IDO-1
NCBI Protein Information
indoleamine 2,3-dioxygenase 1
UniProt Protein Name
Indoleamine 2,3-dioxygenase 1
UniProt Gene Name
IDO1
UniProt Synonym Gene Names
IDO; INDO; IDO-1
UniProt Entry Name
I23O1_HUMAN
Similar Products
Product Notes
The IDO1 ido1 (Catalog #AAA201299) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDO1 antibody - C-terminal region reacts with Tested:Human Predicted: Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's IDO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IDO1 ido1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILIPASQQPK ENKTSEDPSK LEAKGTGGTD LMNFLKTVRS TTEKSLLKEG. It is sometimes possible for the material contained within the vial of "IDO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
