Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281712_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Insulin Receptor antibody . Western blot was performed from the immunoprecipitate using Insulin Receptor at a dilition of 1:1000.)

Rabbit Insulin Receptor Polyclonal Antibody | anti-INSR antibody

Insulin Receptor Rabbit pAb

Gene Names
INSR; HHF5; CD220
Reactivity
Human, Mouse, Rat
Applications
Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
Insulin Receptor, Antibody; Insulin Receptor Rabbit pAb; CD220; HHF5; INSR; anti-INSR antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
Applicable Applications for anti-INSR antibody
IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1281-1382 of human INSR (NP_000199.2).
Cellular Location
Cell membrane, Single-pass type I membrane protein
Positive Samples
HepG2, HeLa, Mouse brain, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Insulin Receptor antibody . Western blot was performed from the immunoprecipitate using Insulin Receptor at a dilition of 1:1000.)

product-image-AAA281712_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Insulin Receptor antibody . Western blot was performed from the immunoprecipitate using Insulin Receptor at a dilition of 1:1000.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Insulin Receptor Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281712_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Insulin Receptor Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-INSR antibody
Background: This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this receptor activates the insulin signaling pathway, which regulates glucose uptake and release, as well as the synthesis and storage of carbohydrates, lipids and protein. Mutations in this gene underlie the inherited severe insulin resistance syndromes including type A insulin resistance syndrome, Donohue syndrome and Rabson-Mendenhall syndrome. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
156,333 Da
NCBI Official Full Name
insulin receptor isoform Long preproprotein
NCBI Official Synonym Full Names
insulin receptor
NCBI Official Symbol
INSR
NCBI Official Synonym Symbols
HHF5; CD220
NCBI Protein Information
insulin receptor; IR
UniProt Protein Name
Insulin receptor
UniProt Gene Name
INSR
UniProt Synonym Gene Names
IR
UniProt Entry Name
INSR_HUMAN

Similar Products

Product Notes

The INSR insr (Catalog #AAA281712) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Insulin Receptor Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Insulin Receptor can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the INSR insr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PTFLEIVNLL KDDLHPSFPE VSFFHSEENK APESEELEME FEDMENVPLD RSSHCQREEA GGRDGGSSLG FKRSYEEHIP YTHMNGGKKN GRILTLPRSN PS. It is sometimes possible for the material contained within the vial of "Insulin Receptor, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.