Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197872_WB10.jpg WB (Western Blot) (WB Suggested Anti-KEAP1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysateKEAP1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit KEAP1 Polyclonal Antibody | anti-KEAP1 antibody

KEAP1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
KEAP1; INrf2; KLHL19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
KEAP1, Antibody; KEAP1 antibody - C-terminal region; anti-KEAP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
Sequence Length
624
Applicable Applications for anti-KEAP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KEAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KEAP1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysateKEAP1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA197872_WB10.jpg WB (Western Blot) (WB Suggested Anti-KEAP1 Antibody Titration: 1.0ug/mlPositive Control: HepG2 cell lysateKEAP1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: KEAP1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.25ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA197872_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KEAP1Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.25ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: KEAP1Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197872_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KEAP1Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA197872_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-KEAP1 antibody
This is a rabbit polyclonal antibody against KEAP1. It was validated on Western Blot and immunohistochemistry

Target Description: KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
Kelch-like ECH-associated protein 1
NCBI Official Synonym Full Names
kelch like ECH associated protein 1
NCBI Official Symbol
KEAP1
NCBI Official Synonym Symbols
INrf2; KLHL19
NCBI Protein Information
kelch-like ECH-associated protein 1
UniProt Protein Name
Kelch-like ECH-associated protein 1
UniProt Gene Name
KEAP1
UniProt Synonym Gene Names
INRF2; KIAA0132; KLHL19; INrf2
UniProt Entry Name
KEAP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KEAP1 keap1 (Catalog #AAA197872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KEAP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KEAP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KEAP1 keap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TWTFVAPMKH RRSALGITVH QGRIYVLGGY DGHTFLDSVE CYDPDTDTWS. It is sometimes possible for the material contained within the vial of "KEAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.