WB (Western Blot)
(WB Suggested Anti-Mapk10 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Rabbit Mapk10 Polyclonal Antibody | anti-MAPK10 antibody
Mapk10 antibody - N-terminal region
Gene Names
Mapk10; Jnk3; SAPb; SAPKC; Serk2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Mapk10, Antibody; Mapk10 antibody - N-terminal region; anti-MAPK10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL
Sequence Length
426
Applicable Applications for anti-MAPK10 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Mapk10 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
WB (Western Blot)
(WB Suggested Anti-Mapk10 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
WB (Western Blot)
(Lanes:Lane1: 40 ug tobacco hornworm larvae intestine lysateLane2: 100 ug tobacco hornworm larvae intestine lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Mapk10(JUNK)Submitted by:Dra. Helena Porta Ducoing and Biol. Gladys Jimenez Nopala)
WB (Western Blot)
(Lanes:Lane1: 40 ug tobacco hornworm larvae intestine lysateLane2: 100 ug tobacco hornworm larvae intestine lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:Mapk10(JUNK)Submitted by:Dra. Helena Porta Ducoing and Biol. Gladys Jimenez Nopala)
Related Product Information for anti-MAPK10 antibody
This is a rabbit polyclonal antibody against Mapk10. It was validated on Western Blot
Target Description: Mapk10 is a stress-activated protein kinase.
Target Description: Mapk10 is a stress-activated protein kinase.
Product Categories/Family for anti-MAPK10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46kDa
NCBI Official Full Name
mitogen-activated protein kinase 10 isoform 2
NCBI Official Synonym Full Names
mitogen activated protein kinase 10
NCBI Official Symbol
Mapk10
NCBI Official Synonym Symbols
Jnk3; SAPb; SAPKC; Serk2
NCBI Protein Information
mitogen-activated protein kinase 10
Similar Products
Product Notes
The MAPK10 (Catalog #AAA200734) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Mapk10 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Mapk10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAPK10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYQNLKPIGS GAQGIVCAAY DAVLDRNVAI KKLSRPFQNQ THAKRAYREL. It is sometimes possible for the material contained within the vial of "Mapk10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.