Rabbit anti-Human MEF2C Polyclonal Antibody | anti-MEF2C antibody
MEF2C Antibody - middle region
Gene Names
MEF2C; DEL5q14.3; C5DELq14.3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MEF2C, Antibody; MEF2C Antibody - middle region; anti-MEF2C antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGM
Sequence Length
417
Applicable Applications for anti-MEF2C antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MEF2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-MEF2C antibody
This is a rabbit polyclonal antibody against MEF2C. It was validated on Western Blot
Target Description: This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe mental retardation, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described.
Target Description: This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe mental retardation, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-MEF2C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
myocyte-specific enhancer factor 2C isoform 2
NCBI Official Synonym Full Names
myocyte enhancer factor 2C
NCBI Official Symbol
MEF2C
NCBI Official Synonym Symbols
DEL5q14.3; C5DELq14.3
NCBI Protein Information
myocyte-specific enhancer factor 2C
UniProt Protein Name
Myocyte-specific enhancer factor 2C
UniProt Gene Name
MEF2C
UniProt Entry Name
MEF2C_HUMAN
Similar Products
Product Notes
The MEF2C mef2c (Catalog #AAA201499) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEF2C Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEF2C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MEF2C mef2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMGGDLTSGA GTSAGNGYGN PRNSPGLLVS PGNLNKNMQA KSPPPMNLGM. It is sometimes possible for the material contained within the vial of "MEF2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
