IF (Immunofluorescence)
(Immunofluorescence analysis of paraffin-embedded rat testis using MMP-1 Rabbit pAb (AAA283192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.)
Rabbit anti-Human MMP-1 Polyclonal Antibody | anti-MMP1 antibody
MMP-1 Rabbit pAb
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
MMP-1, Antibody; MMP-1 Rabbit pAb; CLG; CLGN; MMP-1 (H440); anti-MMP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
FPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Applicable Applications for anti-MMP1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Cross Reactivity
Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 369-469 of human MMP1 (NP_002412.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of paraffin-embedded rat testis using MMP-1 Rabbit pAb (AAA283192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.)
IF (Immunofluorescence)
(Immunofluorescence analysis of paraffin-embedded rat testis using MMP-1 Rabbit pAb (AAA283192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.)
IF (Immunofluorescence)
(Immunofluorescence analysis of paraffin-embedded mouse testis using MMP-1 Rabbit pAb (AAA283192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of paraffin-embedded mouse testis using MMP-1 Rabbit pAb (AAA283192) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)
Related Product Information for anti-MMP1 antibody
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Product Categories/Family for anti-MMP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 54kDa
UniProt Protein Name
Interstitial collagenase
UniProt Gene Name
MMP1
UniProt Synonym Gene Names
CLG; MMP-1
UniProt Entry Name
MMP1_HUMAN
Similar Products
Product Notes
The MMP1 mmp1 (Catalog #AAA283192) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP-1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP-1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the MMP1 mmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FPRTVKHIDA ALSEENTGKT YFFVANKYWR YDEYKRSMDP GYPKMIAHDF PGIGHKVDAV FMKDGFFYFF HGTRQYKFDP KTKRILTLQK ANSWFNCRKN. It is sometimes possible for the material contained within the vial of "MMP-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.