WB (Western Blot)
(Numb antibody - C-terminal region validated by WB using Mouse Brain lysate at 1.0ug/ml.)
Rabbit Numb Polyclonal Antibody | anti-NUMB antibody
Numb antibody - C-terminal region
Gene Names
Numb; Nb
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Numb, Antibody; Numb antibody - C-terminal region; anti-NUMB antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF
Sequence Length
604
Applicable Applications for anti-NUMB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Numb antibody - C-terminal region validated by WB using Mouse Brain lysate at 1.0ug/ml.)
WB (Western Blot)
(Numb antibody - C-terminal region validated by WB using Mouse Brain lysate at 1.0ug/ml.)
WB (Western Blot)
(Sample Type: Rat BrainSample Type:3. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
WB (Western Blot)
(Sample Type: Rat BrainSample Type:3. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
IHC (Immunohistochemistry)
(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Human brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)
IHC (Immunohistochemistry)
(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Human brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)
Related Product Information for anti-NUMB antibody
This is a rabbit polyclonal antibody against Numb. It was validated on Western Blot
Target Description: Numb plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. It is not required for the proliferation of neural progenitor cells before the onset of neurogenesis. It is also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. It may also mediate local repair of brain ventricular wall damage.
Target Description: Numb plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. It is not required for the proliferation of neural progenitor cells before the onset of neurogenesis. It is also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. It may also mediate local repair of brain ventricular wall damage.
Product Categories/Family for anti-NUMB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
protein numb homolog isoform 2
NCBI Official Synonym Full Names
NUMB endocytic adaptor protein
NCBI Official Symbol
Numb
NCBI Official Synonym Symbols
Nb
NCBI Protein Information
protein numb homolog
UniProt Protein Name
Protein numb homolog
UniProt Gene Name
Numb
UniProt Synonym Gene Names
m-Nb; m-Numb
UniProt Entry Name
NUMB_MOUSE
Similar Products
Product Notes
The NUMB numb (Catalog #AAA200933) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Numb antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Numb can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NUMB numb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGNRHAEVP PGTCPVDPFE AQWAALESKS KQRTNPSPTN PFSSDLQKTF. It is sometimes possible for the material contained within the vial of "Numb, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.