Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit PAX4 Polyclonal Antibody | anti-PAX4 antibody

PAX4 antibody - middle region

Gene Names
PAX4; KPD; MODY9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PAX4; Polyclonal Antibody; PAX4 antibody - middle region; anti-PAX4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Specificity
100% homologous to all 3 isoforms (38, 30, 37kDa).
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
Sequence Length
343
Applicable Applications for anti-PAX4 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot) (WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RatTarget Name: PAX4Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RatTarget Name: PAX4Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PAX4Sample Type: OVCAR-3Antibody Dilution: 1.0ug/mlPAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

WB (Western Blot) (Host: RabbitTarget Name: PAX4Sample Type: OVCAR-3Antibody Dilution: 1.0ug/mlPAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

WB (Western Blot)

(Host: RabbitTarget Name: PAX4Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PAX4Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PAX4Sample Type: COLO205Antibody Dilution: 1.0ug/mlPAX4 is supported by BioGPS gene expression data to be expressed in COLO205)

WB (Western Blot) (Host: RabbitTarget Name: PAX4Sample Type: COLO205Antibody Dilution: 1.0ug/mlPAX4 is supported by BioGPS gene expression data to be expressed in COLO205)

WB (Western Blot)

(Host: RabbitTarget Name: PAX4Sample Tissue: Human NCI-H226Antibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: PAX4Sample Tissue: Human NCI-H226Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-PAX4 antibody
This is a rabbit polyclonal antibody against PAX4. It was validated on Western Blot

Target Description: PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Synonym Full Names
paired box 4
NCBI Official Symbol
PAX4
NCBI Official Synonym Symbols
KPD; MODY9
NCBI Protein Information
paired box protein Pax-4
UniProt Protein Name
Paired box protein Pax-4
UniProt Gene Name
PAX4

Similar Products

Product Notes

The PAX4 pax4 (Catalog #AAA23402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAX4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAX4 pax4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTIFSPSQAE ALEKEFQRGQ YPDSVARGKL ATATSLPEDT VRVWFSNRRA. It is sometimes possible for the material contained within the vial of "PAX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.