Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA280969_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PDCD1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit PDCD1 Polyclonal Antibody | anti-PDCD1 antibody

PDCD1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
PDCD1; PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
PDCD1, Antibody; PDCD1 Polyclonal Antibody; CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2; anti-PDCD1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL
Sequence Length
288
Applicable Applications for anti-PDCD1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide of human PDCD1
Immunogen Species
Human
Cellular Location
Membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using PDCD1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA280969_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PDCD1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse bronchial epithelium using PDCD1 antibody at dilution of 1:200 (40x lens).)

product-image-AAA280969_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse bronchial epithelium using PDCD1 antibody at dilution of 1:200 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human skin using PDCD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA280969_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human skin using PDCD1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat bronchial epithelium using PDCD1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA280969_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat bronchial epithelium using PDCD1 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-PDCD1 antibody
This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
Product Categories/Family for anti-PDCD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
programmed cell death protein 1
NCBI Official Synonym Full Names
programmed cell death 1
NCBI Official Symbol
PDCD1
NCBI Official Synonym Symbols
PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1
NCBI Protein Information
programmed cell death protein 1
UniProt Protein Name
Programmed cell death protein 1
UniProt Gene Name
PDCD1
UniProt Synonym Gene Names
PD1; Protein PD-1; hPD-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PDCD1 pdcd1 (Catalog #AAA280969) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PDCD1 pdcd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQIPQAPWPV VWAVLQLGWR PGWFLDSPDR PWNPPTFSPA LLVVTEGDNA TFTCSFSNTS ESFVLNWYRM SPSNQTDKLA AFPEDRSQPG QDCRFRVTQL. It is sometimes possible for the material contained within the vial of "PDCD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.