Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201486_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PLCG2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit PLCG2 Polyclonal Antibody | anti-PLCG2 antibody

PLCG2 Antibody - middle region

Gene Names
PLCG2; FCAS3; APLAID; PLC-IV; PLC-gamma-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLCG2, Antibody; PLCG2 Antibody - middle region; anti-PLCG2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGA
Sequence Length
1265
Applicable Applications for anti-PLCG2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PLCG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PLCG2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA201486_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PLCG2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PLCG2Sample Tissue: Human Fetal LiverAntibody Dilution: 1ug/ml)

product-image-AAA201486_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PLCG2Sample Tissue: Human Fetal LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PLCG2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA201486_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PLCG2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLCG2 antibody
This is a rabbit polyclonal antibody against PLCG2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG), using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane.
Product Categories/Family for anti-PLCG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
NCBI Official Synonym Full Names
phospholipase C gamma 2
NCBI Official Symbol
PLCG2
NCBI Official Synonym Symbols
FCAS3; APLAID; PLC-IV; PLC-gamma-2
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
UniProt Gene Name
PLCG2
UniProt Synonym Gene Names
PLC-IV; PLC-gamma-2
UniProt Entry Name
PLCG2_HUMAN

Similar Products

Product Notes

The PLCG2 plcg2 (Catalog #AAA201486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLCG2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLCG2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PLCG2 plcg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETHLRCAEFE LRLTDPVPNP NPHESKPWYY DSLSRGEAED MLMRIPRDGA. It is sometimes possible for the material contained within the vial of "PLCG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.