WB (Western Blot)
(WB Suggested Anti-PRMT5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePRMT5 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit PRMT5 Polyclonal Antibody | anti-PRMT5 antibody
PRMT5 antibody - N-terminal region
Gene Names
PRMT5; HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
PRMT5, Antibody; PRMT5 antibody - N-terminal region; anti-PRMT5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS
Sequence Length
620
Applicable Applications for anti-PRMT5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT5
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PRMT5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePRMT5 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-PRMT5 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePRMT5 is supported by BioGPS gene expression data to be expressed in Jurkat)
IHC (Immunohiostchemistry)
(Rabbit Anti-PRMT5 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohiostchemistry)
(Rabbit Anti-PRMT5 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-PRMT5 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-PRMT5 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PRMT5 antibody
This is a rabbit polyclonal antibody against PRMT5. It was validated on Western Blot and immunohistochemistry
Target Description: PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.
Target Description: PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.
Product Categories/Family for anti-PRMT5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
protein arginine N-methyltransferase 5 isoform b
NCBI Official Synonym Full Names
protein arginine methyltransferase 5
NCBI Official Symbol
PRMT5
NCBI Official Synonym Symbols
HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5
NCBI Protein Information
protein arginine N-methyltransferase 5
UniProt Protein Name
Protein arginine N-methyltransferase 5
UniProt Gene Name
PRMT5
UniProt Synonym Gene Names
HRMT1L5; IBP72; JBP1; SKB1; SKB1 homolog; SKB1Hs
UniProt Entry Name
ANM5_HUMAN
Similar Products
Product Notes
The PRMT5 prmt5 (Catalog #AAA198576) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRMT5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PRMT5 prmt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDFLCMPVFH PRFKREFIQE PAKNRPGPQT RSDLLLSGRD WNTLIVGKLS. It is sometimes possible for the material contained within the vial of "PRMT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.