Rabbit PSAP Polyclonal Antibody | anti-PSAP antibody

PSAP Rabbit pAb

Cat. Num. AAA28407

• Gene Names: AKR1B1; AR; ADR; ALR2; ALDR1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
• Purity: Affinity purification
• Synonyms: PSAP; Polyclonal Antibody; PSAP Rabbit pAb; GLBA; SAP1; prosaposin; anti-PSAP antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
• Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

• Applicable Applications for anti-PSAP antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200; IF/ICC: 1:50-1:200
• Positive Samples: 293T, HepG2, A-431, Mouse brain, Rat brain
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 275-524 of human PSAP (NP_002769.1).
• Cellular Location: Lysosome, Secreted
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using PSAP Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat spleen using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver using [KO Validated] PSAP Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and PSAP Rabbit pAb knockout (KO) 293T cells, using PSAP Rabbit pAb antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of various lysates, using PSAP Rabbit pAb antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates, using PSAP Rabbit pAb antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

Related Product Information for anti-PSAP antibody

This gene encodes a highly conserved preproprotein that is proteolytically processed to generate four main cleavage products including saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Product Categories/Family for anti-PSAP antibody

Cancer; Signal Transduction; Endocrine & Metabolism; Lipid Metabolism; Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4502049
• NCBI GeneID: 231
• NCBI Accession #: NP_001619.1
• NCBI GenBank Nucleotide #: NM_001628.2
• UniProt Accession #: P15121; Q5U031; Q6FGA4; Q6ICP2; Q9BS21; Q9UCI9; B2R8N3
• Molecular Weight: 35,853 Da
• NCBI Official Full Name: aldose reductase
• NCBI Official Synonym Full Names: aldo-keto reductase family 1, member B1 (aldose reductase)
• NCBI Official Symbol: AKR1B1
• NCBI Official Synonym Symbols: AR; ADR; ALR2; ALDR1
• NCBI Protein Information: aldose reductase; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1
• UniProt Protein Name: Aldose reductase
• UniProt Gene Name: AKR1B1
• UniProt Synonym Gene Names: ALDR1; AR
• UniProt Entry Name: ALDR_HUMAN