<
IHC (Immunohistochemistry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Human Intestinal Cancer Tissue)
RAGE Polyclonal Antibody | anti-RAGE antibody
Anti-RAGE Antibody
Gene Names
AGER; RAGE; SCARJ1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
RAGE, Antibody; Anti-RAGE Antibody; Advanced glycosylation end product-specific receptor; AGER; MGC2235; MGC22357; RAGE_HUMAN; Receptor for advanced glycation endproducts; Receptor for advanced glycosylation end products; advanced glycosylation end product-specific receptor; anti-RAGE antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
404
Applicable Applications for anti-RAGE antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemistry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Human Intestinal Cancer Tissue)
IHC (Immunohistochemistry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Human Intestinal Cancer Tissue)
IHC (Immunohistochemisry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Rat Lung Tissue)
IHC (Immunohistochemisry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Rat Lung Tissue)
IHC (Immunohiostchemistry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Mouse Lung Tissue)
IHC (Immunohiostchemistry)
(Anti- RAGE Picoband antibody, AAA46391, IHC(P)IHC(P): Mouse Lung Tissue)
WB (Western Blot)
(Anti- RAGE Picoband antibody, AAA46391, Western blottingAll lanes: Anti RAGE (AAA46391) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: RH35 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 43KDObserved bind size: 43KD)
WB (Western Blot)
(Anti- RAGE Picoband antibody, AAA46391, Western blottingAll lanes: Anti RAGE (AAA46391) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: RH35 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 43KDObserved bind size: 43KD)
Related Product Information for anti-RAGE antibody
Description: Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor (AGER) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
Background: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
References
1. Bierhaus A, Haslbeck KM, Humpert PM, Liliensiek B, Dehmer T, Morcos M, Sayed AA, Andrassy M, Schiekofer S, Schneider JG, Schulz JB, Heuss D, Neundorfer B, Dierl S, Huber J, Tritschler H, Schmidt AM, Schwaninger M, Haering HU, Schleicher E, Kasper M, Stern DM, Arnold B, Nawroth PP. Loss of pain perception in diabetes is dependent on a receptor of the immunoglobulin superfamily. J Clin Invest. 2004 Dec; 114(12):1741-51. 2. Chavakis T, Bierhaus A, Al-Fakhri N, Schneider D, Witte S, Linn T, Nagashima M, Morser J, Arnold B, Preissner KT, Nawroth PP. The pattern recognition receptor (RAGE) is a counterreceptor for leukocyte integrins: a novel pathway for inflammatory cell recruitment. J Exp Med. 2003 Nov 17; 198(10):1507-15. 3. Hofmann MA, Drury S, Fu C, Qu W, Taguchi A, Lu Y, Avila C, Kambham N, Bierhaus A, Nawroth P, Neurath MF, Slattery T, Beach D, McClary J, Nagashima M, Morser J, Stern D, Schmidt AM. RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides. Cell. 1999 Jun 25; 97(7):889-901. 4. Taguchi A, Blood DC, del Toro G, Canet A, Lee DC, Qu W, Tanji N, Lu Y, Lalla E, Fu C, Hofmann MA, Kislinger T, Ingram M, Lu A, Tanaka H, Hori O, Ogawa S, Stern DM, Schmidt AM. Blockade of RAGE-amphoterin signalling suppresses tumour growth and metastases. Nature.2000 May 18; 405(6784):354-60.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,098 Da
NCBI Official Full Name
advanced glycosylation end product-specific receptor isoform 1
NCBI Official Synonym Full Names
advanced glycosylation end product-specific receptor
NCBI Official Symbol
AGER
NCBI Official Synonym Symbols
RAGE; SCARJ1
NCBI Protein Information
advanced glycosylation end product-specific receptor
UniProt Protein Name
Advanced glycosylation end product-specific receptor
UniProt Gene Name
AGER
UniProt Synonym Gene Names
RAGE
UniProt Entry Name
RAGE_HUMAN
Similar Products
Product Notes
The RAGE ager (Catalog #AAA46391) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-RAGE Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAGE can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RAGE ager for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAGE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.