Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281610_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using RAPGEF1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit RAPGEF1 Polyclonal Antibody | anti-RAPGEF1 antibody

RAPGEF1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
RAPGEF1; C3G; GRF2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
RAPGEF1, Antibody; RAPGEF1 Rabbit pAb; RAPGEF1; C3G; GRF2; anti-RAPGEF1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT
Applicable Applications for anti-RAPGEF1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 844-1095 of human RAPGEF1 (NP_941372.1).
Cellular Location
Early endosome
Positive Samples
Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using RAPGEF1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281610_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using RAPGEF1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using RAPGEF1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281610_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using RAPGEF1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse liver, using RAPGEF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281610_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Mouse liver, using RAPGEF1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-RAPGEF1 antibody
Background: This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120,548 Da
NCBI Official Full Name
rap guanine nucleotide exchange factor 1 isoform a
NCBI Official Synonym Full Names
Rap guanine nucleotide exchange factor (GEF) 1
NCBI Official Symbol
RAPGEF1
NCBI Official Synonym Symbols
C3G; GRF2
NCBI Protein Information
rap guanine nucleotide exchange factor 1; CRK SH3-binding GNRP; guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
UniProt Protein Name
Rap guanine nucleotide exchange factor 1
UniProt Gene Name
RAPGEF1
UniProt Synonym Gene Names
GRF2
UniProt Entry Name
RPGF1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAPGEF1 rapgef1 (Catalog #AAA281610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAPGEF1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAPGEF1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RAPGEF1 rapgef1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARGVAARPGT LHDFHSHEIA EQLTLLDAEL FYKIEIPEVL LWAKEQNEEK SPNLTQFTEH FNNMSYWVRS IIMLQEKAQD RERLLLKFIK IMKHLRKLNN FNSYLAILSA LDSAPIRRLE WQKQTSEGLA EYCTLIDSSS SFRAYRAALS EVEPPCIPYL GLILQDLTFV HLGNPDYIDG KVNFSKRWQQ FNILDSMRCF QQAHYDMRRN DDIINFFNDF SDHLAEEALW ELSLKIKPRN ITRRKTDREE KT. It is sometimes possible for the material contained within the vial of "RAPGEF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.