Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282356_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates, using SLC35A1 Rabbit pAb (AAA282356) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

Rabbit anti-Human, Mouse SLC35A1 Polyclonal Antibody | anti-SLC35A1 antibody

SLC35A1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
SLC35A1; CST; hCST; CDG2F; CMPST
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SLC35A1, Antibody; SLC35A1 Rabbit pAb; CST; hCST; CDG2F; CMPST; anti-SLC35A1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV
Applicable Applications for anti-SLC35A1 antibody
WB (Western Blot)
Positive Samples
Jurkat, MCF7, Mouse testis, Mouse kidney
Cellular Location
Golgi apparatus membrane, Multi-pass membrane protein
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC35A1 (NP_006407.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of various lysates, using SLC35A1 Rabbit pAb (AAA282356) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

product-image-AAA282356_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates, using SLC35A1 Rabbit pAb (AAA282356) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates, using SLC35A1 Rabbit pAb (AAA282356) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

product-image-AAA282356_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using SLC35A1 Rabbit pAb (AAA282356) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
Related Product Information for anti-SLC35A1 antibody
The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SLC35A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,779 Da
NCBI Official Full Name
CMP-sialic acid transporter isoform b
NCBI Official Synonym Full Names
solute carrier family 35 (CMP-sialic acid transporter), member A1
NCBI Official Symbol
SLC35A1
NCBI Official Synonym Symbols
CST; hCST; CDG2F; CMPST
NCBI Protein Information
CMP-sialic acid transporter; CMP-SA-Tr; CMP-Sia-Tr; solute carrier family 35 member A1; mutated CMP-sialic acid transporter A1; solute carrier family 35 (UDP-galactose transporter), member 1; solute carrier family 35 (CMP-sialic acid transporter), member
UniProt Protein Name
CMP-sialic acid transporter
UniProt Gene Name
SLC35A1
UniProt Synonym Gene Names
CMP-SA-Tr; CMP-Sia-Tr
UniProt Entry Name
S35A1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SLC35A1 slc35a1 (Catalog #AAA282356) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC35A1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SLC35A1 slc35a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPRDNVTL LFKLYCLAVM TLMAAVYTIA LRYTRTSDKE LYFSTTAVCI TEVIKLLLSV GILAKETGSL GRFKASLREN VLGSPKELLK LSVPSLVYAV. It is sometimes possible for the material contained within the vial of "SLC35A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.