Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23382_WB6.jpg WB (Western Blot) (WB Suggested Anti-STAT6 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysateSTAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit STAT6 Polyclonal Antibody | anti-STAT6 antibody

STAT6 antibody - C-terminal region

Gene Names
STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
STAT6, Antibody; STAT6 antibody - C-terminal region; anti-STAT6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM
Sequence Length
847
Applicable Applications for anti-STAT6 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STAT6 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysateSTAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA23382_WB6.jpg WB (Western Blot) (WB Suggested Anti-STAT6 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysateSTAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

IHC (Immunohistochemistry)

(STAT6 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

product-image-AAA23382_IHC5.jpg IHC (Immunohistochemistry) (STAT6 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Human Tonsil)

product-image-AAA23382_IHC4.jpg IHC (Immunohistochemistry) (Human Tonsil)

IHC (Immunohistochemistry)

(Human Testis)

product-image-AAA23382_IHC3.jpg IHC (Immunohistochemistry) (Human Testis)

IHC (Immunohistochemistry)

(Human Prostate)

product-image-AAA23382_IHC2.jpg IHC (Immunohistochemistry) (Human Prostate)

IHC (Immunohistochemistry)

(Human Kidney)

product-image-AAA23382_IHC.jpg IHC (Immunohistochemistry) (Human Kidney)
Related Product Information for anti-STAT6 antibody
This is a rabbit polyclonal antibody against STAT6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Full-length human STAR6 (NP_003144) was expressed in E.coli as inclusion body and purified after protein refolding for mouse immunization. Clone 5B1 shows excellent western blot detection of endogenous STAT6 using ACHN cell lysate.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
signal transducer and activator of transcription 6 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 6
NCBI Official Symbol
STAT6
NCBI Official Synonym Symbols
STAT6B; STAT6C; D12S1644; IL-4-STAT
NCBI Protein Information
signal transducer and activator of transcription 6
UniProt Protein Name
Signal transducer and activator of transcription 6
UniProt Gene Name
STAT6
UniProt Entry Name
STAT6_HUMAN

Similar Products

Product Notes

The STAT6 stat6 (Catalog #AAA23382) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the STAT6 stat6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLYPKKPKDE AFRSHYKPEQ MGKDGRGYVP ATIKMTVERD QPLPTPELQM. It is sometimes possible for the material contained within the vial of "STAT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.