Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit TFEB Polyclonal Antibody | anti-TFEB antibody

TFEB Rabbit pAb

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry
Purity
Affinity purification
Synonyms
TFEB; Polyclonal Antibody; TFEB Rabbit pAb; ALPHATFEB; BHLHE35; TCFEB; anti-TFEB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
LPEPEGGLKCLIPEGAVCRGELLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCWAPHPADRPSFSHLEGLLQEA
Applicable Applications for anti-TFEB antibody
Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IF/ICC: 1:50-1:200
IHC: 1:50-1:200
Positive Samples
Raji, Mouse spleen, Mouse heart, Rat thymus
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-173 of human TFEB (NP_009093.1).
Cellular Location
cytoplasm, cytosol, extracellular exosome, microtubule cytoskeleton, mitochondrial inner membrane, mitochondrial intermembrane space, mitochondrial matrix, mitochondrial nucleoid, mitochondrion, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TFEB Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using TFEB Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TFEB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TFEB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-TFEB antibody
Transcription factor that acts as a master regulator of lysosomal biogenesis, autophagy, lysosomal exocytosis, lipid catabolism, energy metabolism and immune response. Specifically recognizes and binds E-box sequences (5'-CANNTG-3'; efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFE3 or MITF. Involved in the cellular response to amino acid availability by acting downstream of MTOR: in the presence of nutrients, TFEB phosphorylation by MTOR promotes its cytosolic retention and subsequent inactivation. Upon starvation or lysosomal stress, inhibition of MTOR induces TFEB dephosphorylation, resulting in nuclear localization and transcription factor activity.
Product Categories/Family for anti-TFEB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
71,922 Da
NCBI Official Full Name
TNK1 protein
NCBI Official Synonym Full Names
tyrosine kinase, non-receptor, 1
NCBI Official Symbol
TNK1
NCBI Protein Information
non-receptor tyrosine-protein kinase TNK1
UniProt Protein Name
Non-receptor tyrosine-protein kinase TNK1
UniProt Gene Name
TNK1
UniProt Entry Name
TNK1_HUMAN

Similar Products

Product Notes

The TFEB tnk1 (Catalog #AAA28425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFEB Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TFEB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunohistochemistry (IHC). WB: 1:500-1:2000 IF/ICC: 1:50-1:200 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the TFEB tnk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPEPEGGLKC LIPEGAVCRG ELLGSGCFGV VHRGLWTLPS GKSVPVAVKS LRVGPEGPMG TELGDFLREV SVMMNLEHPH VLRLHGLVLG QPLQMVMELA PLGSLHARLT APAPTPPLLV ALLCLFLRQL AGAMAYLGAR GLVHRDLATR NLLLASPRTI KVADFGLVRP LGGARGRYVM GGPRPIPYAW CAPESLRHGA FSSASDVWMF GVTLWEMFSG GEEPWAGVPP YLILQRLEDR ARLPRPPLCS RALYSLALRC WAPHPADRPS FSHLEGLLQE A. It is sometimes possible for the material contained within the vial of "TFEB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.