Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46526_IHC13.jpg IHC (Immunohiostchemistry) (Anti- TMEM173 Picoband antibody, AAA46526, IHC(P)IHC(P): Human Lung Cancer Tissue)

anti-Human TMEM173 Polyclonal Antibody | anti-TMEM173 antibody

Anti-TMEM173 Antibody

Average rating 0.0
No ratings yet
Gene Names
TMEM173; ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TMEM173, Antibody; Anti-TMEM173 Antibody; Stimulator of interferon genes protein; endoplasmic reticulum IFN stimulator; Endoplasmic reticulum interferon stimulator; ERIS; FLJ38577; hMITA; hSTING; Mediator of IRF3 activation; MITA; Mitochondrial mediator of IRF3 activation; MPYS; N terminal methionine proline tyrosine serine plasma membrane tetraspanner; NET23; Stimulator of interferon genes; STING; TM173_HUMAN; Tmem173; Transmembrane protein 173; transmembrane protein 173; anti-TMEM173 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
379
Applicable Applications for anti-TMEM173 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- TMEM173 Picoband antibody, AAA46526, IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46526_IHC13.jpg IHC (Immunohiostchemistry) (Anti- TMEM173 Picoband antibody, AAA46526, IHC(P)IHC(P): Human Lung Cancer Tissue)

WB (Western Blot)

(Anti- TMEM173 Picoband antibody, AAA46526, Western blottingAll lanes: Anti TMEM173 (AAA46526) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

product-image-AAA46526_WB15.jpg WB (Western Blot) (Anti- TMEM173 Picoband antibody, AAA46526, Western blottingAll lanes: Anti TMEM173 (AAA46526) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)
Related Product Information for anti-TMEM173 antibody
Description: Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.

Background: Transmembrane protein 173 is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.
References
1. "Entrez Gene: Transmembrane protein 173". 2. Ishikawa, H; Barber, G. N. (2008). "STING is an endoplasmic reticulum adaptor that facilitates innate immune signalling".Nature 455 (7213): 674-8. 3. Nazmi, A; Mukhopadhyay, R; Dutta, K; Basu, A (2012)."STING mediates neuronal innate immune response following Japanese encephalitis virus infection". Scientific Reports 2: 347.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,193 Da
NCBI Official Full Name
stimulator of interferon genes protein isoform 1
NCBI Official Synonym Full Names
transmembrane protein 173
NCBI Official Symbol
TMEM173
NCBI Official Synonym Symbols
ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING
NCBI Protein Information
stimulator of interferon genes protein
UniProt Protein Name
Stimulator of interferon genes protein
UniProt Gene Name
TMEM173
UniProt Synonym Gene Names
ERIS; MITA; STING; hSTING; ERIS; hMITA
UniProt Entry Name
STING_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TMEM173 tmem173 (Catalog #AAA46526) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TMEM173 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM173 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TMEM173 tmem173 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM173, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.