Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224224_IHC13.jpg IHC (Immunohiostchemistry) (TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit TMEM30A Polyclonal Antibody | anti-TMEM30A antibody

TMEM30A antibody

Average rating 0.0
No ratings yet
Gene Names
TMEM30A; CDC50A; C6orf67
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
TMEM30A, Antibody; TMEM30A antibody; Polyclonal TMEM30A; Anti-TMEM30A; FLJ10856; TMEMA 30; Transmembrane Protein 30A; TMEMA-30; TMEM30A; CDC50A; C6orf67; anti-TMEM30A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog, Zebrafish
Clonality
Polyclonal
Specificity
TMEM30A antibody was raised against the N terminal of TMEM30A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM30A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
325
Applicable Applications for anti-TMEM30A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human, Mouse, Rat, Dog, ZebraFish
Immunogen
TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA224224_IHC13.jpg IHC (Immunohiostchemistry) (TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

WB (Western Blot)

(TMEM30A antibody (AAA224224) used at 0.25 ug/ml to detect target protein.)

product-image-AAA224224_WB15.jpg WB (Western Blot) (TMEM30A antibody (AAA224224) used at 0.25 ug/ml to detect target protein.)
Related Product Information for anti-TMEM30A antibody
Rabbit polyclonal TMEM30A antibody raised against the N terminal of TMEM30A
Product Categories/Family for anti-TMEM30A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
TMEM30A protein
NCBI Official Synonym Full Names
transmembrane protein 30A
NCBI Official Symbol
TMEM30A
NCBI Official Synonym Symbols
CDC50A; C6orf67
NCBI Protein Information
cell cycle control protein 50A
UniProt Protein Name
Cell cycle control protein 50A
UniProt Gene Name
TMEM30A
UniProt Synonym Gene Names
C6orf67; CDC50A
UniProt Entry Name
CC50A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TMEM30A tmem30a (Catalog #AAA224224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM30A antibody reacts with Human, Mouse, Rat, Dog, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM30A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TMEM30A tmem30a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM30A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.