Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282281_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse TOM20 Polyclonal Antibody | anti-TOM20 antibody

TOM20 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
LAMP1; LAMPA; CD107a; LGP120
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
TOM20, Antibody; TOM20 Rabbit pAb; TOMM20; MAS20; MOM19; TOM20; translocase of outer mitochondrial membrane 20; anti-TOM20 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
GKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNIN
Applicable Applications for anti-TOM20 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Cellular Location
Mitochondrion outer membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282281_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282281_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-TOM20 antibody
Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,882 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 1
NCBI Official Synonym Full Names
lysosomal-associated membrane protein 1
NCBI Official Symbol
LAMP1
NCBI Official Synonym Symbols
LAMPA; CD107a; LGP120
NCBI Protein Information
lysosome-associated membrane glycoprotein 1; LAMP-1; CD107 antigen-like family member A; lysosome-associated membrane protein 1
UniProt Protein Name
Lysosome-associated membrane glycoprotein 1
UniProt Gene Name
LAMP1
UniProt Synonym Gene Names
LAMP-1
UniProt Entry Name
LAMP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TOM20 lamp1 (Catalog #AAA282281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOM20 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TOM20 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the TOM20 lamp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKENTSDPSL VIAFGRGHTL TLNFTRNATR YSVQLMSFVY NLSDTHLFPN ASSKEIKTVE SITDIRADID KKYRCVSGTQ VHMNNVTVTL HDATIQAYLS NSSFSRGETR CEQDRPSPTT APPAPPSPSP SPVPKSPSVD KYNVSGTNGT CLLASMGLQL NLTYERKDNT TVTRLLNIN. It is sometimes possible for the material contained within the vial of "TOM20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.