Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using WBP11 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit WBP11 Polyclonal Antibody | anti-WBP11 antibody

WBP11 Rabbit pAb

Gene Names
WBP11; NPWBP; SIPP1; WBP-11; PPP1R165
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
WBP11; Polyclonal Antibody; WBP11 Rabbit pAb; NPWBP; PPP1R165; SIPP1; WBP-11; anti-WBP11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIP
Applicable Applications for anti-WBP11 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Customer Validation: WB: Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human WBP11 (NP_057396.1).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
RD, Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using WBP11 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using WBP11 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using WBP11 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using WBP11 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat liver using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat liver using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using WBP11 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using WBP11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

WB (Western Blot) (Western blot analysis of extracts of various cell lines, using WBP11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-WBP11 antibody
Background: This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,998 Da
NCBI Official Full Name
WW domain-binding protein 11
NCBI Official Synonym Full Names
WW domain binding protein 11
NCBI Official Symbol
WBP11
NCBI Official Synonym Symbols
NPWBP; SIPP1; WBP-11; PPP1R165
NCBI Protein Information
WW domain-binding protein 11; Npw38-binding protein NpwBP; SH3 domain-binding protein SNP70; protein phosphatase 1, regulatory subunit 165; splicing factor that interacts with PQBP-1 and PP1; splicing factor, PQBP1 and PP1 interacting
UniProt Protein Name
WW domain-binding protein 11
UniProt Gene Name
WBP11
UniProt Synonym Gene Names
NPWBP; SIPP1; SNP70; WBP-11; NpwBP
UniProt Entry Name
WBP11_HUMAN

Similar Products

Product Notes

The WBP11 wbp11 (Catalog #AAA28323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WBP11 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WBP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200 Customer Validation: WB: Mouse. Researchers should empirically determine the suitability of the WBP11 wbp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRRSTSSTK SGKFMNPTDQ ARKEARKREL KKNKKQRMMV RAAVLKMKDP KQIIRDMEKL DEMEFNPVQQ PQLNEKVLKD KRKKLRETFE RILRLYEKEN PDIYKELRKL EVEYEQKRAQ LSQYFDAVKN AQHVEVESIP. It is sometimes possible for the material contained within the vial of "WBP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.