Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rho-associated protein kinase 2 (Rock2) Recombinant Protein | Rock2 recombinant protein

Recombinant Mouse Rho-associated protein kinase 2 (Rock2) , partial

Gene Names
Rock2; Rock2m; Rock-II; ROKalpha; mKIAA0619; Rho-kinase; B230113H15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho-associated protein kinase 2 (Rock2); N/A; Recombinant Mouse Rho-associated protein kinase 2 (Rock2) , partial; Rock2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
92-354aa; Partial
Sequence
YDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQ HPFF
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Rock2 recombinant protein
This protein is a serine
threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
166,760 Da
NCBI Official Full Name
rho-associated protein kinase 2
NCBI Official Synonym Full Names
Rho-associated coiled-coil containing protein kinase 2
NCBI Official Symbol
Rock2
NCBI Official Synonym Symbols
Rock2m; Rock-II; ROKalpha; mKIAA0619; Rho-kinase; B230113H15Rik
NCBI Protein Information
rho-associated protein kinase 2
UniProt Protein Name
Rho-associated protein kinase 2
UniProt Gene Name
Rock2
UniProt Synonym Gene Names
ROCK-II

Similar Products

Product Notes

The Rock2 rock2 (Catalog #AAA113712) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 92-354aa; Partial. The amino acid sequence is listed below: YDVVKVIGRG AFGEVQLVRH KASQKVYAMK LLSKFEMIKR SDSAFFWEER DIMAFANSPW VVQLFCAFQD DRYLYMVMEY MPGGDLVNLM SNYDVPEKWA KFYTAEVVLA LDAIHSMGLI HRDVKPDNML LDKHGHLKLA DFGTCMKMDE TGMVHCDTAV GTPDYISPEV LKSQGGDGYY GRECDWWSVG VFLFEMLVGD TPFYADSLVG TYSKIMDHKN SLCFPEDTEI SKHAKNLICA FLTDREVRLG RNGVEEIKQ HPFF. It is sometimes possible for the material contained within the vial of "Rho-associated protein kinase 2 (Rock2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.