SWI/SNF complex subunit SMARCC1 (SMARCC1) Recombinant Protein | SMARCC1 recombinant protein

Recombinant Human SWI/SNF complex subunit SMARCC1 (SMARCC1), partial

Cat. Num. AAA117488

• Gene Names: SMARCC1; Rsc8; SRG3; SWI3; BAF155; CRACC1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: SWI/SNF complex subunit SMARCC1 (SMARCC1); N/A; Recombinant Human SWI/SNF complex subunit SMARCC1 (SMARCC1), partial; BRG1-associated factor 155; BAF155; SWI/SNF complex 155 kDa subunit; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1; SMARCC1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 451-671aa. Partial
• Sequence: IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SMARCC1 recombinant protein

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). May stimulate the ATPase activity of the catalytic subunit of the complex. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a st/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural st/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural st cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Product Categories/Family for SMARCC1 recombinant protein

Neuroscience

References

Diversity and specialization of mammalian SWI/SNF complexes.Wang W., Xue Y., Zhou S., Kuo A., Cairns B.R., Crabtree G.R.Genes Dev. 10:2117-2130(1996) Bienvenut W.V., Matallanas D., Cooper W.N., Kolch W.Submitted (JUL-2007) to UniProtKB Mitotic inactivation of a human SWI/SNF chromatin remodeling complex.Sif S., Stukenberg P.T., Kirschner M.W., Kingston R.E.Genes Dev. 12:2842-2851(1998) Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.Anal. Chem. 76:2763-2772(2004) Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Lysine acetylation targets protein complexes and co-regulates major cellular functions.Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.Science 325:834-840(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.Phelan M.L., Sif S., Narlikar G.J., Kingston R.E.Mol. Cell 3:247-253(1999) Cyclin E associates with BAF155 and BRG1, components of the mammalian SWI-SNF complex, and alters the ability of BRG1 to induce growth arrest.Shanahan F., Seghezzi W., Parry D., Mahony D., Lees E.Mol. Cell. Biol. 19:1460-1469(1999) Functional selectivity of recombinant mammalian SWI/SNF subunits.Kadam S., McAlpine G.S., Phelan M.L., Kingston R.E., Jones K.A., Emerson B.M.Genes Dev. 14:2441-2451(2000) Purification and characterization of mSin3A-containing Brg1 and hBrm chromatin remodeling complexes.Sif S., Saurin A.J., Imbalzano A.N., Kingston R.E.Genes Dev. 15:603-618(2001) BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.Hsiao P.W., Fryer C.J., Trotter K.W., Wang W., Archer T.K.Mol. Cell. Biol. 23:6210-6220(2003) Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.Lange M., Kaynak B., Forster U.B., Toenjes M., Fischer J.J., Grimm C., Schlesinger J., Just S., Dunkel I., Krueger T., Mebus S., Lehrach H., Lurz R., Gobom J., Rottbauer W., Abdelilah-Seyfried S., Sperling S.Genes Dev. 22:2370-2384(2008) Ubiquitin-dependent and ubiquitin-independent control of subunit stoichiometry in the SWI/SNF complex.Keppler B.R., Archer T.K.J. Biol. Chem. 285:35665-35674(2010) Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1.RIKEN structural genomics initiative (RSGI) Submitted (APR-2008) to the PDB data bank

NCBI and Uniprot Product Information

• NCBI GI #: 188536047
• NCBI GeneID: 6599
• NCBI Accession #: NP_003065.3
• NCBI GenBank Nucleotide #: NM_003074.3
• UniProt Accession #: Q92922; Q17RS0; Q6P172; Q8IWH2
• Molecular Weight: 27.5 kDa
• NCBI Official Full Name: SWI/SNF complex subunit SMARCC1
• NCBI Official Synonym Full Names: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
• NCBI Official Symbol: SMARCC1
• NCBI Official Synonym Symbols: Rsc8; SRG3; SWI3; BAF155; CRACC1
• NCBI Protein Information: SWI/SNF complex subunit SMARCC1
• UniProt Protein Name: SWI/SNF complex subunit SMARCC1
• UniProt Gene Name: SMARCC1
• UniProt Synonym Gene Names: BAF155; BAF155
• UniProt Entry Name: SMRC1_HUMAN