Protein Wnt-8 Recombinant Protein | wnt8 recombinant protein
Recombinant Xenopus laevis Protein Wnt-8
Gene Names
wnt8a; wnt8; Xwnt8; wnt-8; xwnt-8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Wnt-8; N/A; Recombinant Xenopus laevis Protein Wnt-8; wnt8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-358. Full Length of Mature Protein
Sequence
AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for wnt8 recombinant protein
Ligand for mbers of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.
References
Xwnt-8, a Xenopus Wnt-1/int-1-related gene responsive to mesoderm-inducing growth factors, may play a role in ventral mesodermal patterning during embryogenesis.Christian J.L., McMahon J.A., McMahon A.P., Moon R.T.Development 111:1045-1055(1991) Xwnt-8b a maternally expressed Xenopus Wnt gene with a potential role in establishing the dorsoventral axis.Cui Y., Brown J.D., Moon R.T., Christian J.L.Development 121:2177-2186(1995) Isolation of cDNAs partially encoding four Xenopus Wnt-1/int-1-related proteins and characterization of their transient expression during embryonic development.Christian J.L., Gavin B.J., McMahon A.P., Moon R.T.Dev. Biol. 143:230-234(1991) Specification of mesodermal pattern in Xenopus laevis by interactions between Brachyury, noggin and Xwnt-8.Cunliffe V., Smith J.C.EMBO J. 13:349-359(1994) The head inducer Cerberus is a multifunctional antagonist of Nodal, BMP and Wnt signals.Piccolo S., Agius E., Leyns L., Bhattacharyya S., Grunz H., Bouwmeester T., De Robertis E.M.Nature 397:707-710(1999) Tiki1 is required for head formation via Wnt cleavage-oxidation and inactivation.Zhang X., Abreu J.G., Yokota C., Macdonald B.T., Singh S., Coburn K.L., Cheong S.M., Zhang M.M., Ye Q.Z., Hang H.C., Steen H., He X.Cell 149:1565-1577(2012) Structural basis of Wnt recognition by Frizzled.Janda C.Y., Waghray D., Levin A.M., Thomas C., Garcia K.C.Science 337:59-64(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.7 kDa
NCBI Official Full Name
protein Wnt-8
NCBI Official Synonym Full Names
wingless-type MMTV integration site family member 8A
NCBI Official Symbol
wnt8a
NCBI Official Synonym Symbols
wnt8; Xwnt8; wnt-8; xwnt-8
NCBI Protein Information
protein Wnt-8
UniProt Protein Name
Protein Wnt-8
UniProt Gene Name
wnt8
UniProt Synonym Gene Names
XWnt-8
UniProt Entry Name
WNT8_XENLA
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The wnt8 wnt8 (Catalog #AAA115744) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-358. Full Length of Mature Protein. The amino acid sequence is listed below: AWSVNNFLMT GPKAYLTYSA SVAVGAQNGI EECKYQFAWE RWNCPESTLQ LATHNGLRSA TRETSFVHAI SSAGVMYTLT RNCSMGDFDN CGCDDSRNGR IGGRGWVWGG CSDNAEFGER ISKLFVDGLE TGQDARALMN LHNNEAGRLA VKETMKRTCK CHGISGSCSI QTCWLQLAEF RDIGNHLKIK HDQALKLEMD KRKMRSGNSA DNRGAIADAF SSVAGSELIF LEDSPDYCLK NISLGLQGTE GRECLQSGKN LSQWERRSCK RLCTDCGLRV EEKKTEIISS CNCKFHWCCT VKCEQCKQVV IKHFCARRER DSNMLNTKRK NRGHRR. It is sometimes possible for the material contained within the vial of "Protein Wnt-8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
