Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Botulinum neurotoxin type E Recombinant Protein | BoNT/E recombinant protein

Recombinant Clostridium butyricum Botulinum neurotoxin type E, partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Botulinum neurotoxin type E; Recombinant Clostridium butyricum Botulinum neurotoxin type E; partial; BoNT/E recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-422aa; partial
Sequence
PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for BoNT/E recombinant protein
Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.
References
Sequences of the botulinal neurotoxin E derived from Clostridium botulinum type E (strain Beluga) and Clostridium butyricum (strains 43181 and 43755) .Poulet S., Hauser D., Quanz M., Niemann H., Popoff M.R.Biochem. Biophys. Res. Commun. 183:107-113(1992) Cloning of a DNA fragment encoding the 5'-terminus of the botulinum type E toxin gene from Clostridium butyricum strain BL6340.Fujii N., Kimura K., Murakami T., Indoh T., Tsuzuki K., Yokosawa N., Yashiki T., Oguma K.J. Gen. Microbiol. 137:519-525(1991) Neurotoxin type E from Clostridium botulinum and C. butyricum; partial sequence and comparison.Gimenez J., Foley J., Dasgupta B.R.FASEB J. 2:A1750-A1750(1988)

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
49.7 kDa
UniProt Protein Name
Botulinum neurotoxin type E
UniProt Gene Name
BoNT/E
UniProt Synonym Gene Names
BoNT/E
UniProt Entry Name
BXE_CLOBU

Similar Products

Product Notes

The Botulinum neurotoxin type E bont/e (Catalog #AAA18580) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-422aa; partial. The amino acid sequence is listed below: PTINSFNYND PVNNRTILYI KPGGCQQFYK SFNIMKNIWI IPERNVIGTI PQDFLPPTSL KNGDSSYYDP NYLQSDQEKD KFLKIVTKIF NRINDNLSGR ILLEELSKAN PYLGNDNTPD GDFIINDASA VPIQFSNGSQ SILLPNVIIM GAEPDLFETN SSNISLRNNY MPSNHGFGSI AIVTFSPEYS FRFKDNSMNE FIQDPALTLM HELIHSLHGL YGAKGITTKY TITQKQNPLI TNIRGTNIEE FLTFGGTDLN IITSAQSNDI YTNLLADYKK IASKLSKVQV SNPLLNPYKD VFEAKYGLDK DASGIYSVNI NKFNDIFKKL YSFTEFDLAT KFQVKCRQTY IGQYKYFKLS NLLNDSIYNI SEGYNINNLK VNFRGQNANL NPRIITPITG RGLVKKIIRF CKNIVSVKGI R . It is sometimes possible for the material contained within the vial of "Botulinum neurotoxin type E, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.