papillomavirus type 16 Minor capsid protein L2 (L2) Recombinant Protein | L2 recombinant protein

Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2)

Cat. Num. AAA18603

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: papillomavirus type 16 Minor capsid protein L2 (L2); Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2); L2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-473aa; Full Length
• Sequence: MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIAEQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for L2 recombinant protein

Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, escorts the genomic DNA into the nucleus, in particular by promoting virion endosomal escape. It is involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.

References

Human papillomavirus type 16 DNA sequence.Seedorf K., Krammer G., Durst M., Suhai S., Rowekamp W.G.Virology 145:181-185(1985) Cloning and sequencing of non-European human papillomavirus (HPV) variant complete genomes from cervicovaginal cells by an overlapping PCR method.Terai M., Fu L., Ma Z., Burk R.D. Interaction of human papillomavirus type 16 L2 with cellular proteins identification of novel nuclear body-associated proteins.Goernemann J., Hofmann T.G., Will H., Mueller M.Virology 303:69-78(2002)Interaction of human papillomavirus (HPV)type 16 capsid proteins with HPV DNA requires an intact L2 N-terminal sequence.Zhou J., Sun X.Y., Louis K., Frazer I.H.J. Virol. 68:619-625(1994) Human papillomavirus type 16 capsid proteins produced from recombinant Semliki Forest virus assemble into virus-like particles.Heino P., Dillner J., Schwartz S.Virology 214:349-359(1995) Nuclear translocation of papillomavirus minor capsid protein L2 requires Hsc70.Florin L., Becker K.A., Sapp C., Lambert C., Sirma H., Muller M., Streeck R.E., Sapp M.J. Virol. 78:5546-5553(2004) The l2 minor capsid protein of human papillomavirus type 16 interacts with a network of nuclear import receptors.Darshan M.S., Lucchi J., Harding E., Moroianu J.J. Virol. 78:12179-12188(2004) Human papillomavirus 16 L2 inhibits the transcriptional activation function, but not the DNA replication function, of HPV-16 E2.Okoye A., Cordano P., Taylor E.R., Morgan I.M., Everett R., Campo M.S.Virus Res. 108:1-14(2005) Expression pattern and subcellular localization of human papillomavirus minor capsid protein L2.Lin Z., Yemelyanova A.V., Gambhira R., Jagu S., Meyers C., Kirnbauer R., Ronnett B.M., Gravitt P.E., Roden R.B.Am. J. Pathol. 174:136-143(2009) Two highly conserved cysteine residues in HPV16 L2 form an intramolecular disulfide bond and are critical for infectivity in human keratinocytes.Campos S.K., Ozbun M.A.PLoS ONE 4:E4463-E4463(2009) Identification of the dynein light chains required for human papillomavirus infection.Schneider M.A., Spoden G.A., Florin L., Lambert C.Cell. Microbiol. 13:32-46(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 9627107
• NCBI GeneID: 1489081
• NCBI Accession #: NP_041331.1
• NCBI GenBank Nucleotide #: NC_001526.2
• UniProt Accession #: P03107; Q71BI1
• Molecular Weight: 66.7 kDa
• NCBI Official Full Name: minor capsid protein
• NCBI Official Symbol: L2
• NCBI Protein Information: minor capsid protein
• UniProt Protein Name: Minor capsid protein L2
• UniProt Gene Name: L2
• UniProt Entry Name: VL2_HPV16