Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B) Recombinant Protein | APOBEC3B recombinant protein
Recombinant Human Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B)
Gene Names
APOBEC3B; A3B; ARP4; ARCD3; PHRBNL; APOBEC1L; bK150C2.2; DJ742C19.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B); N/A; Recombinant Human Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B); APOBEC3B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-251, Full length protein
Sequence
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRLRIFSVAFTAAMRSCASWTWFLLCSWTRPRSTGSLGSSPGAPASPGAVPGKCVRSFRRTHT
Sequence Length
251
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for APOBEC3B recombinant protein
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,081 Da
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3B isoform b
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3B
NCBI Official Symbol
APOBEC3B
NCBI Official Synonym Symbols
A3B; ARP4; ARCD3; PHRBNL; APOBEC1L; bK150C2.2; DJ742C19.2
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3B
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3B
UniProt Gene Name
APOBEC3B
UniProt Synonym Gene Names
A3B
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The APOBEC3B apobec3b (Catalog #AAA116875) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-251, Full length protein. The amino acid sequence is listed below: MNPQIRNPME RMYRDTFYDN FENEPILYGR SYTWLCYEVK IKRGRSNLLW DTGVFRGQVY FKPQYHAEMC FLSWFCGNQL PAYKCFQITW FVSWTPCPDC VAKLAEFLSE HPNVTLTISA ARLYYYWERD YRRALCRLSQ AGARVTIMDY EEFAYCWENF VYNEGQQFMP WYKFDENYAF LHRTLKEILR LRIFSVAFTA AMRSCASWTW FLLCSWTRPR STGSLGSSPG APASPGAVPG KCVRSFRRTH T. It is sometimes possible for the material contained within the vial of "Probable DNA dC->dU-editing enzyme APOBEC-3B (APOBEC3B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.