Rabbit anti-Human ARID1A Monoclonal Antibody | anti-ARID1A antibody

ARID1A Rabbit mAb

Cat. Num. AAA282744

• Reactivity: Human
• Applications: ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Affinity purification
• Synonyms: ARID1A, Antibody; ARID1A Rabbit mAb; ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1; ARID1A; anti-ARID1A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: SMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNP

• Applicable Applications for anti-ARID1A antibody: ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1204-1314 of human ARID1A (O14497).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of U-2 OS cells using ARID1A Rabbit mAb (AAA282744,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH-3T3 cells using ARID1A Rabbit mAb (AAA282744,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Rat ovary using ARID1A Rabbit mAb (AAA282744) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using ARID1A Rabbit mAb (AAA282744) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from PC-3 cells, using ARID1A Rabbit mAb (AAA282744) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-ARID1A antibody

This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-ARID1A antibody

Epigenetics Nuclear Signaling; Nuclear Receptor Signaling; Nuclear hormone receptors; Chromatin Remodeling; Cancer; Signal Transduction; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 21264565
• NCBI GeneID: 8289
• NCBI Accession #: NP_006006
• NCBI GenBank Nucleotide #: NM_006015.4
• UniProt Accession #: O14497; Q53FK9; Q5T0W1; Q5T0W2; Q5T0W3; Q8NFD6; Q96T89; Q9BY33; Q9HBJ5; Q9UPZ1; D3DPL1
• Molecular Weight: Calculated MW: 242kDa; Observed MW: 270kDa
• UniProt Protein Name: AT-rich interactive domain-containing protein 1A
• UniProt Gene Name: ARID1A
• UniProt Synonym Gene Names: BAF250; BAF250A; C1orf4; OSA1; SMARCF1; ARID domain-containing protein 1A; BAF250; BAF250A; hOSA1
• UniProt Entry Name: ARI1A_HUMAN