Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistochemistry)
>
<
IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

Rabbit anti-Human ATG7 Monoclonal Antibody | anti-ATG7 antibody

[KD Validated] ATG7 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
ATG7; Monoclonal Antibody; [KD Validated] ATG7 Rabbit mAb; GSA7; [KD Validated] ATG7; anti-ATG7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Applicable Applications for anti-ATG7 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA)
Application Notes
WB: 1:1000-1:6000
IHC-P: 1:200-1:800
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7)(O95352).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] ATG7 Rabbit mAb (AAA28516) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and ATG7 knockdown (KD) HeLa cells using [KD Validated] ATG7 Rabbit mAb (AAA28516) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and ATG7 knockdown (KD) HeLa cells using [KD Validated] ATG7 Rabbit mAb (AAA28516) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates using [KD Validated] ATG7 Rabbit mAb (AAA28516) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot) (Western blot analysis of various lysates using [KD Validated] ATG7 Rabbit mAb (AAA28516) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ATG7 antibody
This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ATG7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 78kDa
Observed MW: 77kDa
UniProt Protein Name
Ubiquitin-like modifier-activating enzyme ATG7
UniProt Gene Name
ATG7
UniProt Synonym Gene Names
APG7L; APG7-like; hAGP7
UniProt Entry Name
ATG7_HUMAN

Similar Products

ATG7 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay, ELISA

ATG7 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunoprecipitation, ELISA

TNF ELISA Kit

Host: n/a
Reactivity: Bovine
Apps: n/a

TNFalpha ELISA Kit

Host: n/a
Reactivity: Porcine
Apps: n/a

TNF-alpha ELISA Kit

Host: n/a
Reactivity: Guinea pig
Apps: n/a

TNF-alpha ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

TNF-alpha ELISA Kit

Host: n/a
Reactivity: Canine
Apps: n/a

TNF-alpha ELISA Kit

Host: n/a
Reactivity: Sheep
Apps: n/a

TNFalpha ELISA Kit

Host: n/a
Reactivity: Bovine
Apps: n/a

TNFalpha ELISA Kit

Host: n/a
Reactivity: Guinea Pig
Apps: n/a

TNF ELISA Kit

Host: n/a
Reactivity: Porcine
Apps: n/a

TNF-alpha ELISA Kit

Host: n/a
Reactivity: Porcine
Apps: n/a

TNFalpha ELISA Kit

Host: n/a
Reactivity: Sheep
Apps: n/a

TNFalpha ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TNFRSF11B ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

ANG-II ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

EMAP-II ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

ANG-II ELISA Kit

Host: n/a
Reactivity: Dog
Apps: n/a

ANG II ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

ANG II ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

Product Notes

The ATG7 atg7 (Catalog #AAA28516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] ATG7 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA). WB: 1:1000-1:6000 IHC-P: 1:200-1:800 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ATG7 atg7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAATGDPGL SKLQFAPFSS ALDVGFWHEL TQKKLNEYRL DEAPKDIKGY YYNGDSAGLP ARLTLEFSAF DMSAPTPARC CPAIGTLYNT NTLESFKTAD. It is sometimes possible for the material contained within the vial of "ATG7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
[email protected]

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.