<
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Jurkat cells (negative control,left) and A549 cells (right) were surface-stained with CD14 Rabbit mAb(AAA282653, 10 ug/mL,green line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
Rabbit anti-Human CD14 Monoclonal Antibody | anti-CD14 antibody
CD14 Rabbit mAb
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CD14, Antibody; CD14 Rabbit mAb; CD14; anti-CD14 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
QPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP
Applicable Applications for anti-CD14 antibody
ELISA, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD14 (P08571).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Jurkat cells (negative control,left) and A549 cells (right) were surface-stained with CD14 Rabbit mAb(AAA282653, 10 ug/mL,green line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Jurkat cells (negative control,left) and A549 cells (right) were surface-stained with CD14 Rabbit mAb(AAA282653, 10 ug/mL,green line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
ICC (Immunocytochemistry)
(Confocal imaging of paraffin-embedded Human tonsil using CD14 Rabbit mAb (AAA282653,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.)
ICC (Immunocytochemistry)
(Confocal imaging of paraffin-embedded Human tonsil using CD14 Rabbit mAb (AAA282653,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.)
ICC (Immunocytochemistry)
(Confocal imaging of THP-1 cells using CD14 Rabbit mAb (AAA282653,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.)
ICC (Immunocytochemistry)
(Confocal imaging of THP-1 cells using CD14 Rabbit mAb (AAA282653,dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CD14 Rabbit mAb (AAA282653) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CD14 Rabbit mAb (AAA282653) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using CD14 Rabbit mAb (AAA282653) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of various lysates using CD14 Rabbit mAb (AAA282653) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-CD14 antibody
The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-CD14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 40kDa
Observed MW: 50-65kDa
Observed MW: 50-65kDa
UniProt Protein Name
Monocyte differentiation antigen CD14
UniProt Gene Name
CD14
UniProt Entry Name
CD14_HUMAN
Similar Products
Product Notes
The CD14 cd14 (Catalog #AAA282653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD14 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD14 can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD14 cd14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPHSLDLSHN SLRATVNPSA PRCMWSSALN SLNLSFAGLE QVPKGLPAKL RVLDLSCNRL NRAPQPDELP EVDNLTLDGN PFLVPGTALP HEGSMNSGVV P. It is sometimes possible for the material contained within the vial of "CD14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.