Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282978_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human spleen tissue using CD163 Rabbit mAb (AAA282978, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.)

Rabbit anti-Human CD163 Monoclonal Antibody | anti-CD163 antibody

CD163 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CD163, Antibody; CD163 Rabbit mAb; M130; MM130; SCARI1; CD163; anti-CD163 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPDTLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLD
Applicable Applications for anti-CD163 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 861-961 of human CD163 (NP_004235.4-).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human spleen tissue using CD163 Rabbit mAb (AAA282978, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.)

product-image-AAA282978_ICC13.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human spleen tissue using CD163 Rabbit mAb (AAA282978, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human liver tissue using CD163 Rabbit mAb (AAA282978, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA282978_ICC15.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Human liver tissue using CD163 Rabbit mAb (AAA282978, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)
Related Product Information for anti-CD163 antibody
The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 125kDa
UniProt Protein Name
Scavenger receptor cysteine-rich type 1 protein M130
UniProt Gene Name
CD163
UniProt Synonym Gene Names
M130; sCD163
UniProt Entry Name
C163A_HUMAN

Similar Products

Product Notes

The CD163 cd163 (Catalog #AAA282978) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD163 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD163 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CD163 cd163 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW GTVCDDSWDL D. It is sometimes possible for the material contained within the vial of "CD163, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.