Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126916_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of U2OS cells using anti-Cyclin T1 antibody (AAA126916).Overlay histogram showing U2OS cells stained with AAA126916 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Cyclin T1 Antibody (AAA126916, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse Cyclin T1 Monoclonal Antibody | anti-CCNT1 antibody

Anti-Cyclin T1 Antibody Picoband (monoclonal, 3B7)

Average rating 0.0
No ratings yet
Gene Names
CCNT1; CCNT; CYCT1; HIVE1
Reactivity
Human, Monkey
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Cyclin T1, Antibody; Anti-Cyclin T1 Antibody Picoband (monoclonal, 3B7); anti-CCNT1 antibody
Ordering
Host
Mouse
Reactivity
Human, Monkey
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
3B7
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-CCNT1 antibody
FCM/FACS (Flow Cytometry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of U2OS cells using anti-Cyclin T1 antibody (AAA126916).Overlay histogram showing U2OS cells stained with AAA126916 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Cyclin T1 Antibody (AAA126916, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126916_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of U2OS cells using anti-Cyclin T1 antibody (AAA126916).Overlay histogram showing U2OS cells stained with AAA126916 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Cyclin T1 Antibody (AAA126916, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of Cyclin T1 using anti-Cyclin T1 antibody (AAA126916).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human Hela whole cell lysates,Lane 3: human SW620 tissue lysates,Lane 4: monkey COS-7 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Cyclin T1 antigen affinity purified monoclonal antibody (#AAA126916) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Cyclin T1 at approximately 81 kDa. The expected band size for Cyclin T1 is at 81 kDa.)

product-image-AAA126916_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of Cyclin T1 using anti-Cyclin T1 antibody (AAA126916).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human Hela whole cell lysates,Lane 3: human SW620 tissue lysates,Lane 4: monkey COS-7 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Cyclin T1 antigen affinity purified monoclonal antibody (#AAA126916) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Cyclin T1 at approximately 81 kDa. The expected band size for Cyclin T1 is at 81 kDa.)
Related Product Information for anti-CCNT1 antibody
Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CCNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
904
UniProt Accession #
Molecular Weight
726
NCBI Official Full Name
Cyclin-T1
NCBI Official Synonym Full Names
cyclin T1
NCBI Official Symbol
CCNT1
NCBI Official Synonym Symbols
CCNT; CYCT1; HIVE1
NCBI Protein Information
cyclin-T1; cyclin C-related protein; CDK9-associated C-type protein; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
UniProt Protein Name
Cyclin-T1
UniProt Gene Name
CCNT1
UniProt Synonym Gene Names
CycT1; Cyclin-T
UniProt Entry Name
CCNT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCNT1 ccnt1 (Catalog #AAA126916) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cyclin T1 Antibody Picoband (monoclonal, 3B7) reacts with Human, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin T1 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the CCNT1 ccnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin T1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.