Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46639_IHC10.jpg IHC (Immunohistochemistry) (Cyclin T1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Cyclin T1 Polyclonal Antibody | anti-CCNT1 antibody

Anti-Cyclin T1 Antibody

Average rating 0.0
No ratings yet
Gene Names
CCNT1; CCNT; CYCT1; HIVE1
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Cyclin T1, Antibody; Anti-Cyclin T1 Antibody; CCN T1; CCNT; CCNT 1; CCNT1; CyclinT; Cyclin T; Cyclin-T; cyclinT1; cyclin-T1; cyclin T1; Cyclin T1b; CYCT 1; CYCT1; HIVE1; O60563; Cyclin-T1; anti-CCNT1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
726
Applicable Applications for anti-CCNT1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Cyclin T1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46639_IHC10.jpg IHC (Immunohistochemistry) (Cyclin T1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(Cyclin T1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46639_IHC11.jpg IHC (Immunohistochemisry) (Cyclin T1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(Cyclin T1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46639_IHC13.jpg IHC (Immunohiostchemistry) (Cyclin T1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Cyclin T1 expression in rat kidney extract (lane 1), mouse spleen extract (lane 2) and JURKAT whole cell lysates (lane 3). Cyclin T1 at 81KD was detected using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46639_WB15.jpg WB (Western Blot) (Western blot analysis of Cyclin T1 expression in rat kidney extract (lane 1), mouse spleen extract (lane 2) and JURKAT whole cell lysates (lane 3). Cyclin T1 at 81KD was detected using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-CCNT1 antibody
Rabbit IgG polyclonal antibody for Cyclin-T1 (CCNT1) detection.
Background: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: CCNT1 cyclin T1".
2. Peng J, Zhu Y, Milton JT, Price DH (April 1998). "Identification of multiple cyclin subunits of human P-TEFb". Genes Dev. 12 (5): 755-62.
3. Wei P, Garber ME, Fang SM, Fischer WH, Jones KA (March 1998). "A novel CDK9-associated C-type cyclin interacts directly with HIV-1 Tat and mediates its high-affinity, loop-specific binding to TAR RNA". Cell92 (4): 451-62.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
904
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,206 Da
NCBI Official Full Name
cyclin-T1 isoform a
NCBI Official Synonym Full Names
cyclin T1
NCBI Official Symbol
CCNT1
NCBI Official Synonym Symbols
CCNT; CYCT1; HIVE1
NCBI Protein Information
cyclin-T1
UniProt Protein Name
Cyclin-T1
UniProt Gene Name
CCNT1
UniProt Synonym Gene Names
CycT1; Cyclin-T
UniProt Entry Name
CCNT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCNT1 ccnt1 (Catalog #AAA46639) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cyclin T1 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin T1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CCNT1 ccnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin T1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.