Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282841_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human esophageal using Cytokeratin 6 (KRT6) (KRT6) Rabbit mAb (AAA282841) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

Rabbit anti-Human Cytokeratin 6 (KRT6) Monoclonal Antibody | anti-KRT6C antibody

Cytokeratin 6 (KRT6) Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Cytokeratin 6 (KRT6), Antibody; Cytokeratin 6 (KRT6) Rabbit mAb; K6E; KRT6E; PPKNEFD; Cytokeratin 6 (KRT6); anti-KRT6C antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH
Applicable Applications for anti-KRT6C antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6)(P48668).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human esophageal using Cytokeratin 6 (KRT6) (KRT6) Rabbit mAb (AAA282841) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282841_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human esophageal using Cytokeratin 6 (KRT6) (KRT6) Rabbit mAb (AAA282841) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using Cytokeratin 6 (KRT6) Rabbit mAb (AAA282841) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA282841_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using Cytokeratin 6 (KRT6) Rabbit mAb (AAA282841) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-KRT6C antibody
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13.
Product Categories/Family for anti-KRT6C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 60kDa
Observed MW: 60kDa
UniProt Protein Name
Keratin, type II cytoskeletal 6C
UniProt Gene Name
KRT6C
UniProt Synonym Gene Names
KRT6E; CK-6C; CK-6E; K6C
UniProt Entry Name
K2C6C_HUMAN

Similar Products

Product Notes

The KRT6C krt6c (Catalog #AAA282841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytokeratin 6 (KRT6) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 6 (KRT6) can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KRT6C krt6c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YRKLLEGEEC RLNGEGVGQV NVSVVQSTIS SGYGGASGVG SGLGLGGGSS YSYGSGLGIG GGFSSSSGRA IGGGLSSVGG GSSTIKYTTT SSSSRKSYKH. It is sometimes possible for the material contained within the vial of "Cytokeratin 6 (KRT6), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.