Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282941_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using ESR? Rabbit mAb (AAA282941) at dilution of 1:100(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human ESRalpha Monoclonal Antibody | anti-ESR1 antibody

ESRalpha Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
ESRalpha, Antibody; ESRalpha Rabbit mAb; ER; ESRalpha; anti-ESR1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVW
Applicable Applications for anti-ESR1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Cross Reactivity
Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ESRalpha (NP_000116.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using ESR? Rabbit mAb (AAA282941) at dilution of 1:100(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA282941_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using ESR? Rabbit mAb (AAA282941) at dilution of 1:100(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using ESR? Rabbit mAb (AAA282941) at dilution of 1:100(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA282941_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using ESR? Rabbit mAb (AAA282941) at dilution of 1:100(40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Related Product Information for anti-ESR1 antibody
This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 66kDa
UniProt Protein Name
Estrogen receptor
UniProt Gene Name
ESR1
UniProt Synonym Gene Names
ESR; NR3A1; ER
UniProt Entry Name
ESR1_HUMAN

Similar Products

Product Notes

The ESR1 esr1 (Catalog #AAA282941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRalpha Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESRalpha can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the ESR1 esr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LNSVSPSPLM LLHPPPQLSP FLQPHGQQVP YYLENEPSGY TVREAGPPAF YRPNSDNRRQ GGRERLASTN DKGSMAMESA KETRYCAVCN DYASGYHYGV W. It is sometimes possible for the material contained within the vial of "ESRalpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.