Mouse anti-Human TARDBP Monoclonal Antibody | anti-TARDBP antibody

TARDBP (TAR DNA-binding Protein 43, TDP43, TDP-43, ALS10) (FITC)

Cat. Num. AAA25272

• Gene Names: TARDBP; ALS10; TDP-43
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TARDBP, Antibody; TARDBP (TAR DNA-binding Protein 43, TDP43, TDP-43, ALS10) (FITC); anti-TARDBP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E2-D3
• Specificity: Recognizes human TARDBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TARDBP antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-261 from TARDBP (AAH01487) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (54.71kD).)

WB (Western Blot)

(TARDBP monoclonal antibody Western Blot analysis of TARDBP expression in A-431.)

WB (Western Blot)

(Western blot analysis of TARDBP over-expressed 293 cell line, cotransfected with TARDBP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TARDBP monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged TARDBP is 0.3ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of TARDBP transfected lysate using TARDBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARDBP rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TARDBP on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody. Lane 1: TARDBP transfected lysate (44.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-TARDBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33876276
• NCBI GeneID: 23435
• Molecular Weight: 31,808 Da
• NCBI Official Full Name: Homo sapiens TAR DNA binding protein, mRNA
• NCBI Official Synonym Full Names: TAR DNA binding protein
• NCBI Official Symbol: TARDBP
• NCBI Official Synonym Symbols: ALS10; TDP-43
• NCBI Protein Information: TAR DNA-binding protein 43