Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198034_WB11.jpg WB (Western Blot) (WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit TARDBP Polyclonal Antibody | anti-TARDBP antibody

TARDBP antibody - N-terminal region

Gene Names
TARDBP; ALS10; TDP-43
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TARDBP, Antibody; TARDBP antibody - N-terminal region; anti-TARDBP antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK
Sequence Length
414
Applicable Applications for anti-TARDBP antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

product-image-AAA198034_WB11.jpg WB (Western Blot) (WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

WB (Western Blot)

(WB Suggested Anti-TARDBP AntibodyPositive Control: Lane 1: 5ug mouse brain cytoplasm Lane 2: 5ug mouse brain nucleusPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit - IR-dyeSecondry Antibody Dilution : 1:10,000Submitted by: Anonymous)

product-image-AAA198034_WB13.jpg WB (Western Blot) (WB Suggested Anti-TARDBP AntibodyPositive Control: Lane 1: 5ug mouse brain cytoplasm Lane 2: 5ug mouse brain nucleusPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti rabbit - IR-dyeSecondry Antibody Dilution : 1:10,000Submitted by: Anonymous)

IHC (Immunohistochemistry)

(Rabbit Anti-TARDBP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198034_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TARDBP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TARDBP antibody
This is a rabbit polyclonal antibody against TARDBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
TAR DNA-binding protein 43
NCBI Official Synonym Full Names
TAR DNA binding protein
NCBI Official Symbol
TARDBP
NCBI Official Synonym Symbols
ALS10; TDP-43
NCBI Protein Information
TAR DNA-binding protein 43
UniProt Protein Name
TAR DNA-binding protein 43
UniProt Gene Name
TARDBP
UniProt Synonym Gene Names
TDP43; TDP-43
UniProt Entry Name
TADBP_HUMAN

Similar Products

Product Notes

The TARDBP tardbp (Catalog #AAA198034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TARDBP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TARDBP can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TARDBP tardbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYVVNYPKDN KRKMDETDAS SAVKVKRAVQ KTSDLIVLGL PWKTTEQDLK. It is sometimes possible for the material contained within the vial of "TARDBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.