Loading...

Skip to main content
IP (Immunoprecipitation) (Immunoprecipitation of TRIM24 transfected lysate using TRIM24 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TRIM24 rabbit polyclonal antibody.)

Mouse anti-Human TRIM24 Monoclonal Antibody | anti-TRIM24 antibody

TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (FITC)

Gene Names
TRIM24; PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM24, Antibody; TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (FITC); anti-TRIM24 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
2F2
Specificity
Recognizes human TRIM24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TRIM24 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa432-569 from TRIM24 (AAH28689) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IP (Immunoprecipitation)

(Immunoprecipitation of TRIM24 transfected lysate using TRIM24 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TRIM24 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of TRIM24 transfected lysate using TRIM24 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TRIM24 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10ug/ml.)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10ug/ml.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6ug/ml].)

WB (Western Blot)

(Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody Lane 1: TRIM24 transfected lysate (116.8kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody Lane 1: TRIM24 transfected lysate (116.8kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in Hela NE.)

WB (Western Blot) (TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in Hela NE.)

WB (Western Blot)

(TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in IMR-32.)

WB (Western Blot) (TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in IMR-32.)
Product Categories/Family for anti-TRIM24 antibody
References
1. TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells. Kikuchi M, Okumura F, Tsukiyama T, Watanabe M, Miyajima N, Tanaka J, Imamura M, Hatakeyama S.Biochim Biophys Acta. 2009 Dec;1793(12):1828-36. Epub 2009 Nov 10.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated Molecular Weight: 117kDa
Observed Molecular Weight: 116kDa
NCBI Official Full Name
Homo sapiens tripartite motif-containing 24, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 24
NCBI Official Symbol
TRIM24
NCBI Official Synonym Symbols
PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
NCBI Protein Information
transcription intermediary factor 1-alpha
UniProt Protein Name
Transcription intermediary factor 1-alpha
UniProt Gene Name
TRIM24
UniProt Synonym Gene Names
RNF82; TIF1; TIF1A; TIF1-alpha
UniProt Entry Name
TIF1A_HUMAN

Similar Products

Product Notes

The TRIM24 trim24 (Catalog #AAA25281) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM24 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM24 trim24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM24, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.