Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283268_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of Bcl2 in 300 ug extracts from mouse lung using 3 ug Bcl2 Rabbit pAb (AAA283268). Western blot analysis was performed using Bcl2 Rabbit pAb (AAA283268) at 1:500 dilution.)

Rabbit anti-Rat Bcl-2 Polyclonal Antibody | anti-Bcl-2 antibody

Bcl-2 Rabbit pAb

Reactivity
Rat
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
Bcl-2, Antibody; Bcl-2 Rabbit pAb; Bcl-2,; anti-Bcl-2 antibody
Ordering
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDD
Applicable Applications for anti-Bcl-2 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of rat Bcl2(NP_058689.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of Bcl2 in 300 ug extracts from mouse lung using 3 ug Bcl2 Rabbit pAb (AAA283268). Western blot analysis was performed using Bcl2 Rabbit pAb (AAA283268) at 1:500 dilution.)

product-image-AAA283268_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of Bcl2 in 300 ug extracts from mouse lung using 3 ug Bcl2 Rabbit pAb (AAA283268). Western blot analysis was performed using Bcl2 Rabbit pAb (AAA283268) at 1:500 dilution.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen using Bcl2 Rabbit pAb (AAA283268) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283268_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse spleen using Bcl2 Rabbit pAb (AAA283268) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-Bcl-2 antibody
Enables BH domain binding activity. Involved in several processes, including response to peptide; response to purine-containing compound; and response to vitamin. Located in cytosol; mitochondrial crista; and perinuclear region of cytoplasm. Used to study several diseases, including brain ischemia (multiple); end stage renal disease; gastric ulcer; intestinal disease (multiple); and status epilepticus. Biomarker of several diseases, including abdominal obesity-metabolic syndrome 1; brain disease (multiple); hypertension (multiple); intrinsic cardiomyopathy (multiple); and neurodegenerative disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); hematologic cancer (multiple); intracranial aneurysm; prostate cancer; and urinary bladder cancer. Orthologous to human BCL2 (BCL2 apoptosis regulator).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 26kDa
Observed MW: 26kDa
UniProt Protein Name
Apoptosis regulator Bcl-2
UniProt Gene Name
Bcl2
UniProt Synonym Gene Names
Bcl-2
UniProt Entry Name
BCL2_RAT

Similar Products

Product Notes

The Bcl-2 bcl2 (Catalog #AAA283268) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bcl-2 Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bcl-2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the Bcl-2 bcl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQAGRTGYD NREIVMKYIH YKLSQRGYEW DTGDEDSAPL RAAPTPGIFS FQPESNRTPA VHRDTAARTS PLRPLVANAG PALSPVPPVV HLTLRRAGDD. It is sometimes possible for the material contained within the vial of "Bcl-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.