Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201197_WB10.jpg WB (Western Blot) (WB Suggested Anti-CLPX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCLPX is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit CLPX Polyclonal Antibody | anti-CLPX antibody

CLPX antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CLPX; EPP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLPX, Antibody; CLPX antibody - C-terminal region; anti-CLPX antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWP
Sequence Length
633
Applicable Applications for anti-CLPX antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CLPX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCLPX is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA201197_WB10.jpg WB (Western Blot) (WB Suggested Anti-CLPX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCLPX is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA201197_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA201197_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201197_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlCLPX is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-CLPX antibody
This is a rabbit polyclonal antibody against CLPX. It was validated on Western Blot

Target Description: CLPX is an ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. CLPX can perform chaperone functions in the absence of clpP.
Product Categories/Family for anti-CLPX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
NCBI Official Synonym Full Names
caseinolytic mitochondrial matrix peptidase chaperone subunit
NCBI Official Symbol
CLPX
NCBI Official Synonym Symbols
EPP2
NCBI Protein Information
ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
UniProt Protein Name
ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
UniProt Gene Name
CLPX
UniProt Entry Name
CLPX_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CLPX clpx (Catalog #AAA201197) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLPX antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CLPX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLPX clpx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFEVPNSDIV CVEVDKEVVE GKKEPGYIRA PTKESSEEEY DSGVEEEGWP. It is sometimes possible for the material contained within the vial of "CLPX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.