Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281612_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MAP3K1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit MAP3K1 Polyclonal Antibody | anti-MAP3K1 antibody

MAP3K1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
MAP3K1, Antibody; MAP3K1 Rabbit pAb; MAP3K1; MAPKKK1; MEKK; MEKK 1; MEKK1; SRXY6; anti-MAP3K1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Applicable Applications for anti-MAP3K1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MAP3K1 (NP_005912.1).
Positive Samples
A-431, Raji, HeLa, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using MAP3K1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281612_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MAP3K1 Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using MAP3K1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281612_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using MAP3K1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human liver using MAP3K1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281612_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human liver using MAP3K1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat liver using MAP3K1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281612_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat liver using MAP3K1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MAP3K1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281612_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MAP3K1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-MAP3K1 antibody
Background: The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161 kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
NCBI Official Symbol
MAP3K1
NCBI Official Synonym Symbols
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 1; MEK kinase 1; MAP/ERK kinase kinase 1; MAPK/ERK kinase kinase 1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 1
UniProt Gene Name
MAP3K1
UniProt Synonym Gene Names
MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
UniProt Entry Name
M3K1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAP3K1 map3k1 (Catalog #AAA281612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP3K1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MAP3K1 map3k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TGAGEFQGQL LGTIAFMAPE VLRGQQYGRS CDVWSVGCAI IEMACAKPPW NAEKHSNHLA LIFKIASATT APSIPSHLSP GLRDVALRCL ELQPQDRPPS RELLKHPVFR TTW. It is sometimes possible for the material contained within the vial of "MAP3K1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.