Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283194_AD13.jpg Application Data (Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat liver using perilipin-2 Rabbit pAb (AAA283194) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse perilipin-2 Polyclonal Antibody | anti-Plin2 antibody

perilipin-2 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Mouse
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry
Purity
Affinity purification
Synonyms
perilipin-2, Antibody; perilipin-2 Rabbit pAb; ADPH; Adfp; Adrp; perilipin-2; anti-Plin2 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Sequence
TVLVNAQGLPQNIQDQAKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNKASLKVQQSEVKAQ
Applicable Applications for anti-Plin2 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry)
Cross Reactivity
Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 325-425 of mouse perilipin-2 (NP_031434.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

Application Data

(Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat liver using perilipin-2 Rabbit pAb (AAA283194) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283194_AD13.jpg Application Data (Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat liver using perilipin-2 Rabbit pAb (AAA283194) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using perilipin-2 Rabbit pAb (AAA283194) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283194_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using perilipin-2 Rabbit pAb (AAA283194) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Related Product Information for anti-Plin2 antibody
Acts upstream of or within lipid storage and long-chain fatty acid transport. Located in several cellular components, including cytosol; lipid droplet; and nucleus. Is expressed in hindlimb tendon and pancreas epithelium. Orthologous to human PLIN2 (perilipin 2).
Product Categories/Family for anti-Plin2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 46kDa
UniProt Protein Name
Perilipin-2
UniProt Gene Name
Plin2
UniProt Synonym Gene Names
Adfp; Adrp; ADRP
UniProt Entry Name
PLIN2_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Plin2 plin2 (Catalog #AAA283194) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The perilipin-2 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's perilipin-2 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the Plin2 plin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TVLVNAQGLP QNIQDQAKHL GVMAGDIYSV FRNAASFKEV SDGVLTSSKG QLQKMKESLD EVMDYFVNNT PLNWLVGPFY PQSTEVNKAS LKVQQSEVKA Q. It is sometimes possible for the material contained within the vial of "perilipin-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.