WB (Western Blot)
(WB Suggested Anti-Prkar1a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Spleen)
Rabbit Prkar1a Polyclonal Antibody | anti-PRKAR1A antibody
Prkar1a Antibody - N-terminal region
Gene Names
Prkar1a; RIIA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Prkar1a, Antibody; Prkar1a Antibody - N-terminal region; anti-PRKAR1A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI
Sequence Length
381
Applicable Applications for anti-PRKAR1A antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prkar1a
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Prkar1a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Spleen)
WB (Western Blot)
(WB Suggested Anti-Prkar1a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Spleen)
WB (Western Blot)
(Host: RabbitTarget Name: PRKAR1ASample Tissue: Rat Mouse ThymusAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PRKAR1ASample Tissue: Rat Mouse ThymusAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKAR1A antibody
This is a rabbit polyclonal antibody against Prkar1a. It was validated on Western Blot
Target Description: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .
Target Description: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .
Product Categories/Family for anti-PRKAR1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
cAMP-dependent protein kinase type I-alpha regulatory subunit
NCBI Official Synonym Full Names
protein kinase cAMP-dependent type 1 regulatory subunit alpha
NCBI Official Symbol
Prkar1a
NCBI Official Synonym Symbols
RIIA
NCBI Protein Information
cAMP-dependent protein kinase type I-alpha regulatory subunit
UniProt Protein Name
cAMP-dependent protein kinase type I-alpha regulatory subunit
UniProt Gene Name
Prkar1a
UniProt Entry Name
KAP0_RAT
Similar Products
Product Notes
The PRKAR1A prkar1a (Catalog #AAA200749) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Prkar1a Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Prkar1a can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKAR1A prkar1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REYFERLEKE EARQIQSLQK SGIRTDSRED EISPPPPNPV VKGRRRRGAI. It is sometimes possible for the material contained within the vial of "Prkar1a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.