Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA117649_SDS_PAGE13.jpg SDS-PAGE

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) Recombinant Protein | PPP1CA recombinant protein

Recombinant Dog Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA); N/A; Recombinant Dog Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA); PPP1CA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-330aa (X155S; X158S); Full Length of Mature Protein
Sequence
There are two ‘X’ in the original sequence (Q8WMS6) which refers to any amino acid. The 'X's have already been with 'S' in the sequence. SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDSFNSLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA117649_SDS_PAGE13.jpg SDS-PAGE

Sequence

(Uniprot Q8WMS6 sequence contains two 'X' (red arrows), X refers to any amino acid. The 'X' have replaced with 'S' for protein manufacture)

product-image-AAA117649_SEQUENCE15.jpg Sequence (Uniprot Q8WMS6 sequence contains two 'X' (red arrows), X refers to any amino acid. The 'X' have replaced with 'S' for protein manufacture)
Related Product Information for PPP1CA recombinant protein
Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+
calmodulin dependent protein kinase II. Component of the PTW
PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates CENPA. Dephosphorylates the 'Ser-139' residue of ATG16L1 causing dissociation of ATG12-ATG5-ATG16L1 complex, thereby inhibiting autophagy
Product Categories/Family for PPP1CA recombinant protein
References
"Protein phosphatase 1 regulates the phosphorylation state of the polarity scaffold Par-3." Traweger A., Wiggin G., Taylor L., Tate S.A., Metalnikov P., Pawson T. Proc. Natl. Acad. Sci. U.S.A. 105:10402-10407(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42.3 kDa
NCBI Official Full Name
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
NCBI Official Symbol
PPP1CA
NCBI Protein Information
serine/threonine-protein phosphatase PP1-alpha catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
UniProt Gene Name
PPP1CA
UniProt Synonym Gene Names
PP-1A

Similar Products

Product Notes

The PPP1CA ppp1ca (Catalog #AAA117649) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-330aa (X155S; X158S); Full Length of Mature Protein. The amino acid sequence is listed below: There are two ‘X’ in the original sequence (Q8WMS6) which refers to any amino acid. The 'X's have already been with 'S' in the sequence. SDS EKLNLDSIIG RLLEVQGSRP GKNVQLTENE IRGLCLKSRE IFLSQPILLE LEAPLKICGD IHGQYYDLLR LFEYGGFPPE SNYLFLGDYV DRGKQSLETI CLLLAYKIKY PENFFLLRGN HECASINRIY GFYDECKRRY NIKLWKTFTD SFNSLPIAAI VDEKIFCCHG GLSPDLQSME QIRRIMRPTD VPDQGLLCDL LWSDPDKDVQ GWGENDRGVS FTFGAEVVAK FLHKHDLDLI CRAHQVVEDG YEFFAKRQLV TLFSAPNYCG EFDNAGAMMS VDETLMCSFQ ILKPADKNKG KYGQFSGLNP GGRPITPPRN SAKAKK. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.