SARS-CoV-1 Spike RBD Coronavirus Recombinant Protein | SARS-CoV-1 recombinant protein
SARS-CoV-1 Spike RBD Coronavirus Recombinant Protein
Purity
>95% as determined by SDS-PAGEAffinity purification chromatography.
Synonyms
SARS-CoV-1 Spike RBD Coronavirus; N/A; SARS-CoV-1 Spike RBD Coronavirus Recombinant Protein; SARS-CoV-1 recombinant protein
Host
HEK293 Cells
Source: SARS-CoV-1
Source: SARS-CoV-1
Purity/Purification
>95% as determined by SDS-PAGE
Affinity purification chromatography.
Affinity purification chromatography.
Form/Format
Liquid in sterile PBS, pH7.4.
Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFHHHHHHHH.
Reconstitution
According to the application.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Recombinant proteins are provided as frozen liquid which are shipped with Dry Ice. Store at -20 degrees C.
Bulk packages can be provided as lyophilized powder which shipped with blue ice. Store reconstituted protein solution at -20 degrees C.
Bulk packages can be provided as lyophilized powder which shipped with blue ice. Store reconstituted protein solution at -20 degrees C.
Related Product Information for SARS-CoV-1 recombinant protein
Description:
A DNA sequence encoding the SARS-CoV-1 Spike Protein (RBD) was expressed with His-tag in C terminus. Mol Mass: The RBD protein of SARS-CoV-1 Spike Protein (RBD) consists of 230 amino acids.
Background:
The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
A DNA sequence encoding the SARS-CoV-1 Spike Protein (RBD) was expressed with His-tag in C terminus. Mol Mass: The RBD protein of SARS-CoV-1 Spike Protein (RBD) consists of 230 amino acids.
Background:
The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Similar Products
Product Notes
The SARS-CoV-1 (Catalog #AAA268877) is a Recombinant Protein produced from HEK293 Cells Source: SARS-CoV-1 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RVVPSGDVVR FPNITNLCPF GEVFNATKFP SVYAWERKKI SNCVADYSVL YNSTFFSTFK CYGVSATKLN DLCFSNVYAD SFVVKGDDVR QIAPGQTGVI ADYNYKLPDD FMGCVLAWNT RNIDATSTGN YNYKYRYLRH GKLRPFERDI SNVPFSPDGK PCTPPALNCY WPLNDYGFYT TTGIGYQPYR VVVLSFELLN APATVCGPKL STDLIKNQCV NFHHHHHHHH. It is sometimes possible for the material contained within the vial of "SARS-CoV-1 Spike RBD Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.