HLA class I histocompatibility antigen, alpha chain G (HLA-G) Recombinant Protein | HLA-G recombinant protein

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Cat. Num. AAA15926

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: HLA class I histocompatibility antigen; alpha chain G (HLA-G); Recombinant Human HLA class I histocompatibility antigen; HLA G antigen; MHC class I antigen G; HLA-G recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-338aa; Full Length of Mature Protein
• Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for HLA-G recombinant protein

Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Product Categories/Family for HLA-G recombinant protein

Immunology

References

The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern of expression.Shukla H., Swaroop A., Srivastava R., Weissman S.M.Nucleic Acids Res. 18:2189-2189(1990) A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment.Geraghty D.E., Koller B.H., Orr H.T.Proc. Natl. Acad. Sci. U.S.A. 84:9145-9149(1987) Ishitani A., Geraghty D.E. A 356-Kb sequence of the subtelomeric part of the MHC class I region.Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M., Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F.DNA Seq. 10:263-299(1999) Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002) Crystal structure of HLA-G a nonclassical MHC class I molecule expressed at the fetal-maternal interface.Clements C.S., Kjer-Nielsen L., Kostenko L., Hoare H.L., Dunstone M.A., Moses E., Freed K., Brooks A.G., Rossjohn J., McCluskey J.Proc. Natl. Acad. Sci. U.S.A. 102:3360-3365(2005) Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 4504415
• NCBI GeneID: 3135
• NCBI Accession #: NP_002118.1
• NCBI GenBank Nucleotide #: NM_002127.5
• UniProt Accession #: P17693
• Molecular Weight: 39.6 kDa
• NCBI Official Full Name: HLA class I histocompatibility antigen, alpha chain G
• UniProt Protein Name: HLA class I histocompatibility antigen, alpha chain G
• UniProt Gene Name: HLA-G
• UniProt Synonym Gene Names: HLA-6.0; HLAG
• UniProt Entry Name: HLAG_HUMAN