Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200866_WB13.jpg WB (Western Blot) (WB Suggested Anti-ATG4D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HCT15 cell lysate)

Rabbit ATG4D Polyclonal Antibody | anti-ATG4D antibody

ATG4D antibody - middle region

Gene Names
ATG4D; APG4D; AUTL4; APG4-D
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATG4D, Antibody; ATG4D antibody - middle region; anti-ATG4D antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP
Sequence Length
474
Applicable Applications for anti-ATG4D antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 90%; Pig: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATG4D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ATG4D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HCT15 cell lysate)

product-image-AAA200866_WB13.jpg WB (Western Blot) (WB Suggested Anti-ATG4D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HCT15 cell lysate)

WB (Western Blot)

(Sample Type: 143BLanes :Lane 1: 20ug 143B lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :ATG4DSubmitted by :Luis Anton, Universidad Autonoma de Madrid)

product-image-AAA200866_WB15.jpg WB (Western Blot) (Sample Type: 143BLanes :Lane 1: 20ug 143B lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :ATG4DSubmitted by :Luis Anton, Universidad Autonoma de Madrid)
Related Product Information for anti-ATG4D antibody
This is a rabbit polyclonal antibody against ATG4D. It was validated on Western Blot

Target Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.
Product Categories/Family for anti-ATG4D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
cysteine protease ATG4D isoform 1
NCBI Official Synonym Full Names
autophagy related 4D cysteine peptidase
NCBI Official Symbol
ATG4D
NCBI Official Synonym Symbols
APG4D; AUTL4; APG4-D
NCBI Protein Information
cysteine protease ATG4D
UniProt Protein Name
Cysteine protease ATG4D
UniProt Gene Name
ATG4D
UniProt Synonym Gene Names
APG4D; AUTL4
UniProt Entry Name
ATG4D_HUMAN

Similar Products

Product Notes

The ATG4D atg4d (Catalog #AAA200866) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG4D antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ATG4D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATG4D atg4d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQGAPELEQE RRHRQIVSWF ADHPRAPFGL HRLVELGQSS GKKAGDWYGP. It is sometimes possible for the material contained within the vial of "ATG4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.